KEGG   Oryctolagus cuniculus (rabbit): 100302454
Entry
100302454         CDS       T03373                                 

Gene name
IL4, BSF-1, IL2
Definition
(RefSeq) interleukin 4
  KO
K05430  interleukin 4
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04151  PI3K-Akt signaling pathway
ocu04630  JAK-STAT signaling pathway
ocu04640  Hematopoietic cell lineage
ocu04657  IL-17 signaling pathway
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu04660  T cell receptor signaling pathway
ocu04664  Fc epsilon RI signaling pathway
ocu04672  Intestinal immune network for IgA production
ocu05140  Leishmaniasis
ocu05200  Pathways in cancer
ocu05310  Asthma
ocu05320  Autoimmune thyroid disease
ocu05321  Inflammatory bowel disease
ocu05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100302454 (IL4)
   04151 PI3K-Akt signaling pathway
    100302454 (IL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100302454 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100302454 (IL4)
   04660 T cell receptor signaling pathway
    100302454 (IL4)
   04658 Th1 and Th2 cell differentiation
    100302454 (IL4)
   04659 Th17 cell differentiation
    100302454 (IL4)
   04657 IL-17 signaling pathway
    100302454 (IL4)
   04664 Fc epsilon RI signaling pathway
    100302454 (IL4)
   04672 Intestinal immune network for IgA production
    100302454 (IL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100302454 (IL4)
  09163 Immune disease
   05310 Asthma
    100302454 (IL4)
   05320 Autoimmune thyroid disease
    100302454 (IL4)
   05321 Inflammatory bowel disease
    100302454 (IL4)
   05330 Allograft rejection
    100302454 (IL4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100302454 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100302454 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100302454 (IL4)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interleukins
   100302454 (IL4)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Haparin
  Cytokines
   100302454 (IL4)
SSDB
Motif
Pfam: IL4
Other DBs
NCBI-GeneID: 100302454
NCBI-ProteinID: NP_001156649
Ensembl: ENSOCUG00000011943
UniProt: Q9MZR8 A5Z1F6
LinkDB
Position
3
AA seq 147 aa
MGLPAQLPVTLLCLLAGTAHFIQGRRGDIILPEVIKTLNILTERKTPCTKLMIADALAVP
KNTTEREAVCRAATALRQFYLHHKVSWCFKEHGELGDLRLLRGLDRNLCSMAKLSNCPGK
EARQTTLEDFLDRLKTAMQEKYSKRQS
NT seq 444 nt   +upstreamnt  +downstreamnt
atggggctccctgcccagctgcctgtcactctgctctgcctcctcgcaggcaccgcgcac
ttcatccaggggcgcaggggcgacatcatcctacccgaagtcatcaaaaccctgaacatc
ctcacagagagaaagactccatgcaccaagctgatgatagcagacgccctggccgtcccc
aagaacacaaccgagagagaggccgtctgcagggccgcgactgcactccggcagttctac
ctccaccacaaggtgtcttggtgcttcaaggagcacggagagctcggtgacctcagactc
ctgagaggactcgacaggaacctctgcagcatggcgaagctgagcaactgtcctgggaag
gaagccagacagactacactggaagacttcttagacaggctaaagaccgccatgcaagag
aaatactcaaagcgtcagagctga

DBGET integrated database retrieval system