KEGG   Oryctolagus cuniculus (rabbit): 100302458
Entry
100302458         CDS       T03373                                 

Gene name
IL2, TCGF
Definition
(RefSeq) interleukin 2
  KO
K05429  interleukin 2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04151  PI3K-Akt signaling pathway
ocu04625  C-type lectin receptor signaling pathway
ocu04630  Jak-STAT signaling pathway
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu04660  T cell receptor signaling pathway
ocu04672  Intestinal immune network for IgA production
ocu04940  Type I diabetes mellitus
ocu05135  Yersinia infection
ocu05142  Chagas disease (American trypanosomiasis)
ocu05162  Measles
ocu05166  Human T-cell leukemia virus 1 infection
ocu05200  Pathways in cancer
ocu05320  Autoimmune thyroid disease
ocu05321  Inflammatory bowel disease (IBD)
ocu05330  Allograft rejection
ocu05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    100302458 (IL2)
   04151 PI3K-Akt signaling pathway
    100302458 (IL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100302458 (IL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100302458 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100302458 (IL2)
   04660 T cell receptor signaling pathway
    100302458 (IL2)
   04658 Th1 and Th2 cell differentiation
    100302458 (IL2)
   04659 Th17 cell differentiation
    100302458 (IL2)
   04672 Intestinal immune network for IgA production
    100302458 (IL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100302458 (IL2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100302458 (IL2)
   05321 Inflammatory bowel disease (IBD)
    100302458 (IL2)
   05330 Allograft rejection
    100302458 (IL2)
   05332 Graft-versus-host disease
    100302458 (IL2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100302458 (IL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100302458 (IL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100302458 (IL2)
   05162 Measles
    100302458 (IL2)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    100302458 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100302458 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100302458 (IL2)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Interleukins
   100302458 (IL2)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Haparin
  Cytokines
   100302458 (IL2)
SSDB
Motif
Pfam: IL2 IL15
Other DBs
NCBI-GeneID: 100302458
NCBI-ProteinID: NP_001156652
Ensembl: ENSOCUG00000010100
UniProt: O77620
LinkDB
Position
15
AA seq 153 aa
MYKVQLLSCIALTLALLTSSAPTSSSTKETQEQLDQLLLDLQVLLKGVNDYKNSKLSRML
TFKFYMPKKVTELKHLQCLEEELKPLEEVLNLAQGKNSHGGNTRESISNINVTVLKLKGS
ETFMCEYDETVTIVEFLNRWITFCQSIISASSS
NT seq 462 nt   +upstreamnt  +downstreamnt
atgtacaaagtacaactcttgtcttgcattgcactaactcttgcactccttacaagcagt
gcacctacttcaagttctacaaaggaaacacaggaacaactggatcagctactgctggat
ttacaggtgcttttgaaaggagttaatgattataagaattccaaactttccaggatgctc
acattcaaattttatatgcccaagaaggtcacagaattgaaacatcttcagtgtctagaa
gaagaactcaaacctctggaggaagtgcttaacttagctcaaggcaaaaactctcatggg
ggaaataccagagaatcaatcagcaatattaatgtaacagttctgaaactaaagggatct
gaaacattcatgtgtgaatacgatgagacagttaccattgtagaatttctgaacagatgg
atcaccttttgtcaaagcatcatctcagcatcgagttcataa

DBGET integrated database retrieval system