KEGG   Oryctolagus cuniculus (rabbit): 100316908
Entry
100316908         CDS       T03373                                 

Gene name
HGF
Definition
(RefSeq) hepatocyte growth factor
  KO
K05460  hepatocyte growth factor
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01521  EGFR tyrosine kinase inhibitor resistance
ocu04010  MAPK signaling pathway
ocu04014  Ras signaling pathway
ocu04015  Rap1 signaling pathway
ocu04020  Calcium signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04510  Focal adhesion
ocu05144  Malaria
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05211  Renal cell carcinoma
ocu05218  Melanoma
ocu05223  Non-small cell lung cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100316908 (HGF)
   04014 Ras signaling pathway
    100316908 (HGF)
   04015 Rap1 signaling pathway
    100316908 (HGF)
   04020 Calcium signaling pathway
    100316908 (HGF)
   04151 PI3K-Akt signaling pathway
    100316908 (HGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100316908 (HGF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100316908 (HGF)
   05205 Proteoglycans in cancer
    100316908 (HGF)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100316908 (HGF)
   05226 Gastric cancer
    100316908 (HGF)
   05218 Melanoma
    100316908 (HGF)
   05211 Renal cell carcinoma
    100316908 (HGF)
   05223 Non-small cell lung cancer
    100316908 (HGF)
  09174 Infectious disease: parasitic
   05144 Malaria
    100316908 (HGF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100316908 (HGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100316908 (HGF)
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100316908 (HGF)
Cytokines and growth factors [BR:ocu04052]
 Growth factors
  Growth factors (RTK binding)
   100316908 (HGF)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100316908 (HGF)
SSDB
Motif
Pfam: Kringle Trypsin PAN_1 DUF1986 CWC25
Other DBs
NCBI-GeneID: 100316908
NCBI-ProteinID: NP_001162178
Ensembl: ENSOCUG00000001618
UniProt: C9E9X4
LinkDB
Position
7
AA seq 730 aa
MWVSKLVPVLLLQQVLLHLLLLPIAIPYAEGQKKRRNTLHEFKKSAKTILIKEDPLLKIK
TKKMNTADQCANRCIRNKGLPFTCKAFVFDKTKKRCLWFPFNSMSSGVKKEFGHEFDLYE
NKDYIRNCIIGKGGSYKGTVSITKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNP
RGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGPMDHTESGKICQRWDHQTP
HRHKFLPERYPDKGFDDNYCRNPDGKPRPWCYTLDPDTPWEYCAIKMCAHSIMNDTDVPM
ETTECIQGQGEGYRGTINTIWNGIPCQRWDSQYPHQHDITPENFKCKDLRENYCRNPDGA
ESPWCFTTDPNIRVGYCSQIPKCDVSSGQDCYLGNGKNYMGNLSKTRSGLTCSMWDKNME
DLHRHTFWEPDASKLNKNYCRNPDDDAHGPWCYTGNPLVPWDYCPLARCEGDTTPTIVNL
DHPVVSCAKTKQLRVVNGIPTRTNVGWMVSLKYRNKHICGGSLIKESWVLTARQCFPSRN
KDLKDYEAWLGIHDVHGRGDEKRKQVLNVSQLVYGPEGSDLVLLKLARPAVLDDFVSTID
LPNYGCIIPEKTACSVYGWGYTGLINSDGLLRVAHLYIMGNEKCSQHHQGKVTLKESEIC
AGAEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHK
IILTYKVPQP
NT seq 2193 nt   +upstreamnt  +downstreamnt
atgtgggtgtccaaacttgtgccagtcctgctgctgcagcaggtcctgctgcatctcctg
ctgctgcccatcgccatcccctacgcagagggacagaagaagagaagaaatacacttcat
gaatttaaaaagtcagcaaagacgattcttatcaaagaagacccattactgaagataaaa
actaaaaaaatgaacacagcagaccaatgtgccaacagatgtattaggaataaaggactt
ccattcacttgcaaggcctttgtttttgataaaacaaaaaaacgatgcctctggtttcct
ttcaatagcatgtccagtggagtgaaaaaagagtttggtcatgaatttgacctctatgaa
aacaaagactacattagaaactgcatcattggtaaaggaggcagctataagggaacagtg
tctattactaagagtggcatcaagtgtcagccctggagttccatgataccacatgaacac
agctttttgccttcgagctatcgcggtaaagacctacaggaaaactactgtcgaaatcct
cgtggggaagaagggggaccgtggtgtttcacaagcaatccagaggtacgctacgaagtc
tgtgacattcctcaatgttcagaagttgaatgtatgacctgcaatggggaaagttatcga
ggccccatggatcacacagaatcaggcaagatttgtcagcgctgggaccatcagacacca
caccggcacaaattcttgcccgaaagatatcccgacaagggctttgatgataattattgc
cgcaatcctgatggcaagccgaggccatggtgttatactcttgaccctgacaccccctgg
gagtactgtgcaattaaaatgtgtgctcacagtattatgaatgacactgatgtccctatg
gaaacaacggaatgcattcaaggtcaaggagaaggttacaggggaaccatcaataccatt
tggaatggaattccttgtcagcgttgggattcccagtatcctcaccagcatgacataact
cccgaaaatttcaagtgcaaggacctacgagaaaattattgccgaaatccagatggggct
gagtcaccctggtgtttcaccactgacccaaacatccgagttggctactgctcccaaatt
ccaaaatgtgatgtgtcaagtggacaagattgctatcttgggaatggcaagaattatatg
ggcaatttatccaaaacaagatctggactgacgtgttcaatgtgggacaagaacatggaa
gacttgcatcgccacaccttctgggaaccagatgctagtaagctgaacaagaattactgc
cggaatcccgacgatgatgcccacggaccctggtgttacacagggaatcctcttgtgcct
tgggattattgtcctcttgctcgttgtgaaggtgatactacccccacaatagtgaattta
gaccatcctgtagtatcttgtgccaaaacaaagcaattgcgagttgtcaatgggattcca
acacgaacaaatgtgggatggatggttagtttgaaatacagaaataaacatatctgcgga
ggatcattgataaaggaaagctgggttcttacggcaagacaatgtttcccttctcgaaat
aaagacttgaaggattacgaagcctggctgggaattcacgatgtccacggaagaggtgat
gagaagcgcaagcaggtgctgaacgtctcgcagctggtgtacgggcccgaaggatctgat
ctggttttactgaagcttgcgagacctgctgtcctggatgattttgttagcacgattgac
ttacctaattatggatgcatcattcctgagaagactgcttgcagtgtttatggttggggc
tacaccggattgatcaactctgacggtctattacgagttgcacatctctatattatgggg
aatgagaaatgcagtcagcaccatcaaggaaaagtgactctgaaagaatctgaaatatgt
gctggagcagagaagattggatcaggaccttgtgagggggattatggtggcccacttgtt
tgtgaacaacataaaatgagaatggttcttggagtcattgttcccggtcgtggatgtgcc
attccaaatcgtcctggtatcttcgtccgagtggcatattatgcaaagtggatacacaaa
attatattaacgtataaggtgccacagccataa

DBGET integrated database retrieval system