KEGG   Oryctolagus cuniculus (rabbit): 100327265
Entry
100327265         CDS       T03373                                 

Gene name
MYC, C-MYC
Definition
(RefSeq) v-myc avian myelocytomatosis viral oncogene homolog
  KO
K04377  Myc proto-oncogene protein
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04012  ErbB signaling pathway
ocu04110  Cell cycle
ocu04151  PI3K-Akt signaling pathway
ocu04218  Cellular senescence
ocu04310  Wnt signaling pathway
ocu04350  TGF-beta signaling pathway
ocu04390  Hippo signaling pathway
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04630  JAK-STAT signaling pathway
ocu04919  Thyroid hormone signaling pathway
ocu05132  Salmonella infection
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05163  Human cytomegalovirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05169  Epstein-Barr virus infection
ocu05200  Pathways in cancer
ocu05202  Transcriptional misregulation in cancer
ocu05205  Proteoglycans in cancer
ocu05206  MicroRNAs in cancer
ocu05210  Colorectal cancer
ocu05213  Endometrial cancer
ocu05216  Thyroid cancer
ocu05219  Bladder cancer
ocu05220  Chronic myeloid leukemia
ocu05221  Acute myeloid leukemia
ocu05222  Small cell lung cancer
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
ocu05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100327265 (MYC)
   04012 ErbB signaling pathway
    100327265 (MYC)
   04310 Wnt signaling pathway
    100327265 (MYC)
   04350 TGF-beta signaling pathway
    100327265 (MYC)
   04390 Hippo signaling pathway
    100327265 (MYC)
   04630 JAK-STAT signaling pathway
    100327265 (MYC)
   04151 PI3K-Akt signaling pathway
    100327265 (MYC)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100327265 (MYC)
   04218 Cellular senescence
    100327265 (MYC)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100327265 (MYC)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100327265 (MYC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100327265 (MYC)
   05202 Transcriptional misregulation in cancer
    100327265 (MYC)
   05206 MicroRNAs in cancer
    100327265 (MYC)
   05205 Proteoglycans in cancer
    100327265 (MYC)
   05230 Central carbon metabolism in cancer
    100327265 (MYC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100327265 (MYC)
   05225 Hepatocellular carcinoma
    100327265 (MYC)
   05226 Gastric cancer
    100327265 (MYC)
   05216 Thyroid cancer
    100327265 (MYC)
   05221 Acute myeloid leukemia
    100327265 (MYC)
   05220 Chronic myeloid leukemia
    100327265 (MYC)
   05219 Bladder cancer
    100327265 (MYC)
   05213 Endometrial cancer
    100327265 (MYC)
   05224 Breast cancer
    100327265 (MYC)
   05222 Small cell lung cancer
    100327265 (MYC)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100327265 (MYC)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100327265 (MYC)
   05161 Hepatitis B
    100327265 (MYC)
   05160 Hepatitis C
    100327265 (MYC)
   05163 Human cytomegalovirus infection
    100327265 (MYC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100327265 (MYC)
   05169 Epstein-Barr virus infection
    100327265 (MYC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    100327265 (MYC)
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100327265 (MYC)
Transcription factors [BR:ocu03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    100327265 (MYC)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     100327265 (MYC)
SSDB
Motif
Pfam: Myc_N Myc-LZ HLH
Other DBs
NCBI-GeneID: 100327265
NCBI-ProteinID: NP_001306504
Ensembl: ENSOCUG00000014289
UniProt: G1T737
LinkDB
Position
3
AA seq 438 aa
MPLNVSFATNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTP
PLSPSRRSGLCSPSYVAVASFSPRGDDGGGGGSFSTADQLEMVTELLGGDMVNQSFICDP
DDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPSPARGHGGCSTSSLYLQ
DLSAAASECIDPSVVFPYPLHDSSSPKPCASPDSSAFSPSSDSLLSSNESSPRASPEPLV
LHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQPSTKRSGSPSAGGHSKPPHSPLVLKRCH
VSTHQHNYAAPPSTRKDYPAAKRAKLDSGRVLKQISNNRRCASPRSSDTEENDKRRTHNV
LERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILAVQAEEQKLISEKDLLR
KRREQLKHKLEQLRNSCA
NT seq 1317 nt   +upstreamnt  +downstreamnt
atgcccctcaacgtcagcttcgccaccaacaggaactatgacctggactacgactcggtg
cagccctatttctactgcgatgaggaggagaacttctaccagcagcagcagcagagcgag
ctgcagccgccggcgcccagcgaggatatctggaagaaattcgagctgctgcccaccccg
cccctgtccccgagccgccgctccggcctctgctcgccctcctacgttgccgtcgcgtcc
ttctcccccaggggagacgacggcggcggcggcggcagcttctccacggctgaccagctg
gagatggtcaccgagctgctgggcggtgacatggtgaaccagagcttcatctgcgacccg
gacgacgagaccttcatcaagaacatcatcatccaggactgcatgtggagcggcttctcg
gccgccgccaagctcgtctcggagaagctggcctcctaccaggctgcgcgcaaggacagc
ggcagcccgagccccgcccgcggccacggcggctgctccacctccagcctgtacctgcag
gacctgagcgccgccgcctccgaatgcatcgacccctcggtggtcttcccctacccactg
cacgacagcagctcgcccaagccctgcgcctcgcccgactccagcgccttctccccgtcc
tcggactctctgctctcctccaacgagtcctctccgcgggccagccctgagcccctggtg
ctccatgaagagacaccgcccaccaccagcagcgactctgaggaagaacaagaggatgag
gaagaaatcgatgtcgtttctgtggaaaagaggcagccctccaccaaaaggtcagggtca
ccatctgcagggggccacagcaaacctccacacagcccgctggtcctcaagaggtgccac
gtctccacccatcagcacaattacgccgcgcccccatccaccaggaaggactacccagct
gccaagcgggccaagttggacagtggccgagtcctgaagcagatcagcaacaatcgcaga
tgtgccagccccaggtcctcagacaccgaggagaacgacaagaggcggacacacaacgtc
ttggaacgccagaggagaaatgagctgaaaaggagcttttttgccctgcgtgaccagatc
ccagagttggaaaacaatgaaaaggcccccaaggtagttatccttaaaaaagccacggcg
tacatcctggccgtccaagcagaggagcaaaagctcatttcagagaaggacttgttgcgg
aaacggcgagaacagttgaaacacaaacttgaacagctacggaactcttgtgcataa

DBGET integrated database retrieval system