KEGG   Oryctolagus cuniculus (rabbit): 100328584Help
Entry
100328584         CDS       T03373                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase complex flavoprotein subunit A
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00020  Citrate cycle (TCA cycle)
ocu00190  Oxidative phosphorylation
ocu01100  Metabolic pathways
ocu01200  Carbon metabolism
ocu04714  Thermogenesis
ocu04932  Non-alcoholic fatty liver disease (NAFLD)
ocu05010  Alzheimer disease
ocu05012  Parkinson disease
ocu05016  Huntington disease
Module
ocu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ocu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ocu_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100328584 (SDHA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100328584 (SDHA)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    100328584 (SDHA)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    100328584 (SDHA)
   05012 Parkinson disease
    100328584 (SDHA)
   05016 Huntington disease
    100328584 (SDHA)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100328584 (SDHA)
Enzymes [BR:ocu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     100328584 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 100328584
NCBI-ProteinID: XP_017194705
LinkDB All DBs
Position
Un
AA seq 665 aa AA seqDB search
MAGVRVVSRLLLARRLALTRAQRPAALQTGTRDFHFTVDGHTRASAKVSDSISAQYPVVD
HEFDAVVVGAGGAGLRAAFGLSEAGFNTACITKLFPTRSHTVAAQGGINAALGNMEEDNW
RWHFYDTVKGSDWLGDQDAIHYMTEQAPASVVELENYGMPFSRTEDGRIYQRAFGGQSLK
FGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCI
EDGSIHRIRAKNTVVATGGYGRTYFSCTSAHTSTGDGTAMVTRAGLPCQDLEFVQFHPTG
IYGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGCGP
EKDHVYLQLHHLPPEQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKG
QVLRHVNGQDQIVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIAESCRPGD
KVPPIKPNAGEESVMNLDKLRFADGSIRTSELRLSMQKSMQSHAAVFRVGSVLQEGCEKI
SQLYGDLKHLKTFDRGMVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDYKV
RIDEYDYSKPIQGQQKKPFGEHWRKHTLSYVDVKTGKVTLEYRPVIDKTLNEADCATVPP
AIRSY
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atggctggggtccgagtggtgtcgcggctgctgttggcgcggcgtttggcgctgacccgg
gcgcagcggccggcagcactgcagacaggaacccgtgattttcacttcactgttgatggc
catacaagggcatctgccaaagtctcagattccatttctgctcagtacccagtagtggac
catgaatttgatgcagtggtggtcggtgctggtggagctggcttacgagctgcatttggc
ctctcggaggcaggatttaacacagcatgcatcacaaagctctttcctaccaggtcacac
actgtggcggcacagggaggcatcaatgctgctctgggaaatatggaagaagacaattgg
agatggcatttctacgacaccgtgaagggctctgactggctgggggaccaggacgccatc
cactacatgacagagcaagcccctgcctctgtggtcgagctagaaaattatggcatgcca
tttagcagaactgaagacgggaggatctatcagcgtgcgttcggtggacagagcctcaag
tttgggaaaggcgggcaggcccaccgatgctgctgtgtggctgatcggaccggccactca
ctcctgcacaccttgtatggaaggtctctgcgatatgataccagctattttgtggagtac
tttgccttggatcttctgatggagaatggggagtgtcgtggtgttatcgcgctgtgcata
gaagatgggtccatccaccgcatacgagcaaagaacactgttgttgcgaccggaggctat
gggcgcacttacttcagctgcacgtctgcccacaccagcaccggtgatgggacagccatg
gtcaccagggccggccttccttgccaggacttggagttcgtccagttccaccccacaggc
atatatggtgctggttgtctcattacagaaggttgccgtggagagggaggcattctcatt
aacagtcagggcgaaaggttcatggagagatacgcccctgtcgcgaaggacctggcttcc
agagatgtggtgtctcgatcaatgaccctggagatccgagaaggaagaggctgtggcccc
gagaaggatcatgtctacctgcagctgcaccatctgccacccgagcagctggccacacgc
ctgcctggcatttctgagacggccatgatcttcgcgggtgtggacgtcaccaaggagcca
atccctgtgctccccacggtgcactataacatgggcggcattcctaccaactacaaggga
caggttctgaggcacgtgaatggccaggatcagattgtgcccggcctgtatgcctgtggg
gaggctgcctgtgcctcggtacacggtgccaaccggctcggggcaaactcgctgctggac
ttggtggtctttggccgggcctgtgccctgagcattgcagagtcctgcagacccggagat
aaagtccccccgattaaaccaaatgcaggggaagaatctgttatgaatcttgacaagttg
agatttgctgatgggagcatcaggacgtcggagctgcgcctcagcatgcagaagtctatg
cagagtcatgctgcagtgttccgtgttgggagcgtgttgcaggaaggctgtgagaagatc
agccagctctacggagacctgaagcacctgaagacgtttgacagggggatggtctggaat
acagacttggtggagaccctggagctgcaaaatctgatgctgtgtgcgctgcagaccatc
tacggagctgaggctcggaaggagtctcggggtgcccacgccagggaggattacaaggtg
cggatcgatgagtacgattactccaagcctattcaagggcagcagaagaagccgtttggg
gagcactggaggaagcacaccctttcttacgttgatgtcaagactgggaaggtcactctg
gagtacagacctgtaattgacaaaaccttgaacgaagctgactgcgccacagtgccccct
gccatccgctcctactga

DBGET integrated database retrieval system