KEGG   Oryctolagus cuniculus (rabbit): 100328700
Entry
100328700         CDS       T03373                                 

Gene name
XIAP
Definition
(RefSeq) X-linked inhibitor of apoptosis
  KO
K04725  E3 ubiquitin-protein ligase XIAP [EC:2.3.2.27]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01524  Platinum drug resistance
ocu04064  NF-kappa B signaling pathway
ocu04120  Ubiquitin mediated proteolysis
ocu04210  Apoptosis
ocu04215  Apoptosis - multiple species
ocu04217  Necroptosis
ocu04510  Focal adhesion
ocu04621  NOD-like receptor signaling pathway
ocu05145  Toxoplasmosis
ocu05166  Human T-cell leukemia virus 1 infection
ocu05200  Pathways in cancer
ocu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100328700 (XIAP)
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100328700 (XIAP)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100328700 (XIAP)
   04215 Apoptosis - multiple species
    100328700 (XIAP)
   04217 Necroptosis
    100328700 (XIAP)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100328700 (XIAP)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100328700 (XIAP)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100328700 (XIAP)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100328700 (XIAP)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100328700 (XIAP)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100328700 (XIAP)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100328700 (XIAP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ocu01002]
    100328700 (XIAP)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100328700 (XIAP)
   03029 Mitochondrial biogenesis [BR:ocu03029]
    100328700 (XIAP)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100328700 (XIAP)
Peptidases and inhibitors [BR:ocu01002]
 Peptidase inhibitors
  Family I32: IAP family
   100328700 (XIAP)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    100328700 (XIAP)
Mitochondrial biogenesis [BR:ocu03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    100328700 (XIAP)
SSDB
Motif
Pfam: BIR zf-C3HC4_3 Prok-RING_4 zf-C3HC4_2 zf-RING_UBOX DUF2039
Other DBs
NCBI-GeneID: 100328700
NCBI-ProteinID: NP_001164796
Ensembl: ENSOCUG00000009878
UniProt: B7NZG8
LinkDB
Position
X
AA seq 497 aa
MTFNSFEGSKTCVPADINKDEEFVEEFNRLKTFANFPSSSPVSASTLARAGFLYTGEGDT
VRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFINGFYFENSAAQSTNPGVQNGQYKGENY
LGNRNHFALDRPSETHADYLLRTGQVVDISDTIYPRNPAMCSEEARLKSFQNWPDYAHLT
PRELASAGLYYTGIDDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNVNIRSE
SDVVSSDRNFPNSTNPPRNPAMADYEARIISFGTWIYSVNKEQLARAGFYALGEGDKVKC
FHCGGGLTDWKPNEDPWEQHAKWYPGCKYLLEEKGQEYINNIHLTHSLEESLARTAENTP
SQTKRIDDTIFQSPMVQEAIRMGFSFREIKKIMEEKVQMCGSNYKSLEVLVADLVNAQKS
STQDESSQTSLQKEVSTEEQLRRLQEEKLCKICMDRNIAVVFIPCGHLVTCKQCAEAVDK
CPMCYTVITFKQKIFMS
NT seq 1494 nt   +upstreamnt  +downstreamnt
atgacttttaacagttttgaaggatctaaaacttgtgtacctgcagacatcaataaagat
gaagaatttgtagaagagtttaatagattaaaaacttttgctaattttccaagtagtagt
cctgtttcagcgtcaacactggcacgagcaggttttctttatactggtgaaggagacact
gtgcgatgctttagttgtcatgcagcagtagatagatggcaatatggagactcagcagtt
ggaagacacaggaaagtatccccaaattgcagatttatcaacggcttttattttgaaaat
agtgctgcacaatctacaaatcctggtgtccagaatggtcaatacaaaggtgaaaactac
ctgggaaacagaaatcattttgctttagacagaccatctgagactcacgcagactatctt
ttgagaactggacaggttgtagatatatcagacaccatatacccaaggaaccctgccatg
tgtagtgaagaagctagattaaagtcatttcagaactggccagactatgcccacctaacc
cccagagagttagctagtgctgggctctactacacaggtattgatgatcaagtgcaatgc
ttttgttgtggtggaaaactgaaaaattgggaaccttgtgatcgtgcctggtcggaacat
aggcgacactttcctaattgcttctttgttttgggccggaacgttaatattcgaagtgaa
tctgatgttgtgagttctgataggaattttccaaattcaacaaatcctccaagaaatcca
gccatggcagattatgaagcacggatcatttcttttgggacgtggatatactcagttaac
aaggagcagcttgcaagagctggattttatgctttaggtgaaggtgataaagtaaagtgc
tttcactgtggaggagggctaactgattggaagcccaatgaagacccttgggaacaacat
gctaagtggtatccagggtgtaaatatctattagaagagaaaggacaagaatatataaac
aatattcatttaactcattcacttgaggaatctctggcaagaactgctgaaaacacacca
tcacaaactaaaagaattgatgataccatcttccaaagtcctatggtacaagaagctata
cgaatgggattcagtttcagggagattaagaaaataatggaggaaaaagttcagatgtgt
gggagcaactataaatcacttgaggttctggttgcagatctagtgaatgctcagaaaagc
agtacacaagacgaatcaagtcagacttcattacagaaagaagttagtactgaagagcag
ctaaggcgcctgcaagaggagaagctttgcaaaatctgcatggatagaaatattgctgta
gtttttattccttgtggacatctggtcacttgtaaacaatgtgctgaagcagttgacaaa
tgccccatgtgctacacagtgattactttcaagcaaaaaatttttatgtcttaa

KEGG   Oryctolagus cuniculus (rabbit): 100338118
Entry
100338118         CDS       T03373                                 

Gene name
BIRC2
Definition
(RefSeq) baculoviral IAP repeat containing 2
  KO
K16060  baculoviral IAP repeat-containing protein 2/3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01524  Platinum drug resistance
ocu04064  NF-kappa B signaling pathway
ocu04120  Ubiquitin mediated proteolysis
ocu04210  Apoptosis
ocu04215  Apoptosis - multiple species
ocu04217  Necroptosis
ocu04390  Hippo signaling pathway
ocu04510  Focal adhesion
ocu04621  NOD-like receptor signaling pathway
ocu04668  TNF signaling pathway
ocu05132  Salmonella infection
ocu05145  Toxoplasmosis
ocu05168  Herpes simplex virus 1 infection
ocu05200  Pathways in cancer
ocu05202  Transcriptional misregulation in cancer
ocu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100338118 (BIRC2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100338118 (BIRC2)
   04064 NF-kappa B signaling pathway
    100338118 (BIRC2)
   04668 TNF signaling pathway
    100338118 (BIRC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100338118 (BIRC2)
   04215 Apoptosis - multiple species
    100338118 (BIRC2)
   04217 Necroptosis
    100338118 (BIRC2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100338118 (BIRC2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100338118 (BIRC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100338118 (BIRC2)
   05202 Transcriptional misregulation in cancer
    100338118 (BIRC2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100338118 (BIRC2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100338118 (BIRC2)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100338118 (BIRC2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100338118 (BIRC2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100338118 (BIRC2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ocu01002]
    100338118 (BIRC2)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100338118 (BIRC2)
Peptidases and inhibitors [BR:ocu01002]
 Peptidase inhibitors
  Family I32: IAP family
   100338118 (BIRC2)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    100338118 (BIRC2)
SSDB
Motif
Pfam: BIR CARD zf-C3HC4_3 Prok-RING_4 zf-C3HC4_2 DUF2039
Other DBs
NCBI-GeneID: 100338118
NCBI-ProteinID: XP_017199160
Ensembl: ENSOCUG00000013890
LinkDB
Position
1
AA seq 598 aa
MMEDSTILSTWTNDNKQKMKYDFSCELYRMSTYSAFPNGVPVSERSLARAGFYYTGVNDK
VKCFCCGLMLDNWKQGDNPIEKHKQLYPSCSFIQNLVSASLDSTIKNTSPVRSSFAHSLS
PTVEPGGSFSGSYSSLSANPLNSRTVEDFSPLRTNPYSYSMSSEEARFLTYHMWPLSFLS
PSELARAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSEHRRHFPKCPFLENSLETLRFS
ISNLSMQTHASRMRTFMYWPSSAPVGPEQLASAGFYYVGRNDDVKCFCCDGGLRCWESGD
DPWVEHAKWFPRCEFLIRMKGQEFVDEIQARFPHLLEQLLSTSDPPGEENADPPIVHFGP
GESSSEDAVMMNTPVVKAALEMGFSKSLVKQTVQSKILTTGENYKTVNDIVSALLNAEDE
KREEEKERQAEEVASDDLSLIRKNRMALFQQLTCVLPILDHLLKANVINKQEHDIIKQKT
QIPLQARELIDTVLVKGNVAANIFKNCLKEIDSTLYENLFVEKNMKYIPTEDASGLSLEE
QLRRLQEERTCKVCMDKEVSIVFIPCGHLVVCQGCAPSLRKCPICRGIIKGTVRTFLS
NT seq 1797 nt   +upstreamnt  +downstreamnt
atgatggaagacagcaccatcttgtcaacttggacaaatgacaacaaacaaaaaatgaag
tatgacttctcttgcgaactctacagaatgtctacctactcagctttccccaacggtgtt
cctgtctcagaacggagtcttgctcgtgctggtttctattacactggagtgaatgacaag
gtcaaatgcttctgttgtggcctgatgttggataactggaaacaaggagacaatcctatt
gaaaagcataaacagctgtatcctagctgtagttttattcagaatctggtttcagctagt
ctggactccaccattaagaatacgtctccagtgagaagtagttttgcacattcattatct
cccactgtggaaccaggtggctcgttcagtggttcttactccagcctttcagcaaaccct
cttaattctagaacagtcgaagacttttctccactgaggactaacccctatagttattca
atgagttctgaagaggcaagatttcttacttaccatatgtggccattaagctttttgtcg
ccatcagaattggcaagagctggcttctattatataggacctggagatagggtagcctgc
tttgcatgtggtgggaagctaagcaactgggagccaaaggatgatgctatgtcagagcac
cggagacatttccccaaatgtccatttttggaaaattctctagaaacactgaggtttagc
atttcaaatctgagcatgcagacacatgcatctcgaatgagaacatttatgtattggcca
tctagtgctccagttggtcctgagcagcttgcaagtgctggtttttattatgtgggtcgc
aatgatgatgtgaaatgcttttgttgtgatggtggcttgaggtgttgggaatctggagat
gatccatgggtcgaacatgccaagtggtttccaaggtgtgaattcttgatacgcatgaaa
gggcaggagtttgttgatgagattcaagctagatttcctcatcttcttgaacagttgttg
tcaacttcagacccccctggagaagaaaatgctgatccaccaattgttcattttggacct
ggagaaagttcttcagaagatgcagtcatgatgaatactcctgtggttaaagctgcctta
gaaatgggctttagtaaaagccttgtaaaacagacagtccagagtaaaattctaacaact
ggagagaactataaaacagtcaatgatattgtgtcagcacttcttaatgctgaagatgag
aaaagagaagaggagaaggaaagacaagctgaagaagtggcatcagacgacttgtcatta
attcggaagaatagaatggctctctttcaacagttgacatgtgtgcttcctatcctggat
catcttttaaaagccaatgtaattaacaagcaggaacatgatattattaaacaaaaaaca
cagatacctttacaagcaagagagctgattgatactgttttagttaaaggaaatgtggca
gccaacatcttcaaaaactgtctgaaagaaattgactctacattgtatgagaacttattt
gtggaaaagaacatgaagtatattccaacagaagatgcttcaggtctgtcactggaagaa
cagttgaggaggttgcaagaagaacgaacttgtaaagtgtgtatggacaaagaagtttct
attgtattcattccctgtggtcatcttgtagtgtgccaaggatgtgccccttctctaaga
aaatgccctatttgcaggggtataatcaagggtacagttcgcacatttctctcataa

KEGG   Oryctolagus cuniculus (rabbit): 100340120
Entry
100340120         CDS       T03373                                 

Gene name
BIRC3
Definition
(RefSeq) baculoviral IAP repeat containing 3
  KO
K16060  baculoviral IAP repeat-containing protein 2/3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01524  Platinum drug resistance
ocu04064  NF-kappa B signaling pathway
ocu04120  Ubiquitin mediated proteolysis
ocu04210  Apoptosis
ocu04215  Apoptosis - multiple species
ocu04217  Necroptosis
ocu04390  Hippo signaling pathway
ocu04510  Focal adhesion
ocu04621  NOD-like receptor signaling pathway
ocu04668  TNF signaling pathway
ocu05132  Salmonella infection
ocu05145  Toxoplasmosis
ocu05168  Herpes simplex virus 1 infection
ocu05200  Pathways in cancer
ocu05202  Transcriptional misregulation in cancer
ocu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100340120 (BIRC3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100340120 (BIRC3)
   04064 NF-kappa B signaling pathway
    100340120 (BIRC3)
   04668 TNF signaling pathway
    100340120 (BIRC3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100340120 (BIRC3)
   04215 Apoptosis - multiple species
    100340120 (BIRC3)
   04217 Necroptosis
    100340120 (BIRC3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100340120 (BIRC3)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100340120 (BIRC3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100340120 (BIRC3)
   05202 Transcriptional misregulation in cancer
    100340120 (BIRC3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100340120 (BIRC3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100340120 (BIRC3)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100340120 (BIRC3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100340120 (BIRC3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100340120 (BIRC3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ocu01002]
    100340120 (BIRC3)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100340120 (BIRC3)
Peptidases and inhibitors [BR:ocu01002]
 Peptidase inhibitors
  Family I32: IAP family
   100340120 (BIRC3)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    100340120 (BIRC3)
SSDB
Motif
Pfam: BIR CARD zf-C3HC4_3 Prok-RING_4 zf-C3HC4_2 zf-RING_5 DUF2039 zf-RING_UBOX OTT_1508_deam
Other DBs
NCBI-GeneID: 100340120
NCBI-ProteinID: XP_002708629
Ensembl: ENSOCUG00000010109
LinkDB
Position
1
AA seq 604 aa
MNIVENSIFLANLMKSANTFELKYDFSCELYRMSTYSTFPAGVPVSERSLARAGFYYTGV
NDKVKCFCCGLMLDNWKQGDKPIEKHRKLYPSCSFVQSLNSVNNWEANSRSTFPSSVTNS
THSFLPSWEHSGYYSGSYSSLPSNPVNSRANQDFSAFRVSPYHSAMSTEKARLLTFQSWP
LTFLSPMDLAKAGFYYVGPGDRVACFACGGKLSNWEPKDDAMSEHLRHFPNCPFVENQLQ
DASRYTISNLSMQTHAARFKTFFNWPSSLLVHPEQLASAGFYYVGHSDDVKCFCCDGGLR
CWELGDDPWVEHAKWFPRCEYLIRIKGQEFISRVQASYPHLLEQLLSTSDTPEDENAEPP
IVHFGPGENPSEDAVMMNTPVVKAALDMGFSRRLVKQTVQSKILATGENYKTISDLVLDL
LNAEDEIREEEKERASEEKESDDLSLIRRNRMALFQHLTCVIPILDSLLTSGVINEQEHA
VIKQKTQTSLQARELIDIILVKGNIAATVFKDCLQETDPVLYKHLFVQQDIKYIPTEDVS
DLPMEEQLRRLQEERTCKVCMDKEVSIVFIPCGHLVVCKDCAPSLRKCPICRGTIKGTVR
TFLS
NT seq 1815 nt   +upstreamnt  +downstreamnt
atgaacatagtagaaaatagcatctttttagcgaatttgatgaaaagcgccaacactttt
gaactgaaatacgacttttcgtgtgagctctaccgaatgtccacatattccacgttccct
gctggggtccctgtctcggaacggagtcttgctcgtgctggtttctattacactggagtg
aatgacaaggtcaaatgcttctgttgtggcctgatgttggataactggaaacaaggagac
aaacccatcgaaaagcacaggaagttgtatcctagttgcagctttgtgcagagtctcaac
tccgtcaacaattgggaagcaaactctcggtctacttttccctcttccgtcacaaactcc
acacattcattcctcccaagttgggaacacagtggctattacagcggttcgtattcaagt
cttccatcaaatcctgtaaactccagagccaatcaagatttttctgccttcagggtgagt
ccctaccactctgcgatgagtaccgaaaaagccagattactcaccttccagtcgtggcca
ttgacctttctgtcaccgatggatctggcaaaagcaggcttttactacgtaggaccgggg
gacagagtggcttgcttcgcctgtgggggaaaactgagcaactgggagccgaaggatgat
gctatgtcagaacacctgagacatttccccaactgtccatttgtagaaaatcagctccaa
gatgcttcgagatacaccatttcgaacctgagcatgcagacccatgctgcccgcttcaaa
acattctttaactggccctcgagtcttctagttcatcctgagcagctcgcgagcgcagga
ttttactatgtgggtcacagtgacgacgtcaagtgcttttgctgcgatggtggactgagg
tgctgggaactgggagatgacccgtgggtggaacatgccaagtggtttccaaggtgtgaa
tatttgataagaattaaaggacaggaattcatcagtagagtccaagccagttaccctcat
ctacttgagcagctgttatccacatcagacactccagaagatgaaaatgcagagccacca
attgttcattttggacctggtgaaaacccttcagaagatgcagtcatgatgaatacgcca
gtggttaaagctgccttggacatgggcttcagcagaaggctagtgaagcagacagtccag
agtaaaatcctagccactggagagaactacaaaaccatcagcgatcttgtactggatttg
ctaaatgcagaagatgaaataagggaagaggagaaggaaagagcaagcgaggaaaaagag
tcagatgatctgtcgttaattcggaggaatagaatggcactttttcaacatttgacttgt
gtgataccaatcctggacagtcttctaacttctggagtgattaatgagcaagaacatgct
gttattaaacagaaaacacaaacatctttacaagccagagaactcattgatattatttta
gtaaaaggaaatattgcagccaccgtattcaaagattgtttacaagaaactgaccctgtg
ttatacaagcatttatttgtgcaacaggacataaagtacattcccacggaagatgtttca
gatttaccaatggaagaacaattgcggagattacaagaagaaagaacatgtaaagtgtgt
atggacaaagaagtgtccattgtgtttattccttgtggtcacctagttgtatgcaaagat
tgtgccccttctctaagaaaatgtcctatttgtaggggtacaatcaagggtacagttcgc
acatttctttcataa

KEGG   Oryctolagus cuniculus (rabbit): 103346801
Entry
103346801         CDS       T03373                                 

Gene name
BIRC5
Definition
(RefSeq) baculoviral IAP repeat containing 5
  KO
K08731  baculoviral IAP repeat-containing protein 5
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01524  Platinum drug resistance
ocu04210  Apoptosis
ocu04215  Apoptosis - multiple species
ocu04390  Hippo signaling pathway
ocu05161  Hepatitis B
ocu05200  Pathways in cancer
ocu05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    103346801 (BIRC5)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103346801 (BIRC5)
   04215 Apoptosis - multiple species
    103346801 (BIRC5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103346801 (BIRC5)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103346801 (BIRC5)
  09172 Infectious disease: viral
   05161 Hepatitis B
    103346801 (BIRC5)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    103346801 (BIRC5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ocu01002]
    103346801 (BIRC5)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ocu03036]
    103346801 (BIRC5)
Peptidases and inhibitors [BR:ocu01002]
 Peptidase inhibitors
  Family I32: IAP family
   103346801 (BIRC5)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CPC (chromosomal passenger complex)
     103346801 (BIRC5)
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    103346801 (BIRC5)
SSDB
Motif
Pfam: BIR
Other DBs
NCBI-GeneID: 103346801
NCBI-ProteinID: XP_017195702
LinkDB
Position
Un
AA seq 142 aa
MDARSLPRAWQLYLKDHRVSTFKNWPFLEGCACTPERMAEAGFIHCPSENEPDLAQCFFC
FKELEGWEPDDEPLEEHRKHSPACAFLSVKKQLEELTLSEFLKLDKERAKNKIAKETSSK
QKEFEETAKKVRSAIEQLAALQ
NT seq 429 nt   +upstreamnt  +downstreamnt
atggacgcccggtcgttgccccgggcttggcagctctatctcaaggaccaccgcgtctcg
acgttcaagaactggcccttcctggagggctgcgcctgcaccccggagcggatggccgag
gccggcttcatccactgcccctctgagaacgagcccgacctggcccagtgtttcttctgc
ttcaaggagctcgagggctgggagccggacgacgagcccctggaggagcacaggaagcac
tcgcccgcgtgcgcgttcctgtctgtcaagaagcagctggaagaactgacgctcagcgag
tttctgaagctggacaaagagcgagccaagaacaagatcgccaaggagaccagcagtaag
cagaaggagttcgaggagaccgcgaagaaggtgcgctccgccatcgagcagctggccgcg
ctgcagtga

DBGET integrated database retrieval system