KEGG   Oryctolagus cuniculus (rabbit): 100328905
Entry
100328905         CDS       T03373                                 

Gene name
IKBKG
Definition
(RefSeq) inhibitor of nuclear factor kappa B kinase subunit gamma
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01523  Antifolate resistance
ocu04010  MAPK signaling pathway
ocu04014  Ras signaling pathway
ocu04062  Chemokine signaling pathway
ocu04064  NF-kappa B signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04210  Apoptosis
ocu04380  Osteoclast differentiation
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04623  Cytosolic DNA-sensing pathway
ocu04625  C-type lectin receptor signaling pathway
ocu04657  IL-17 signaling pathway
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu04660  T cell receptor signaling pathway
ocu04662  B cell receptor signaling pathway
ocu04668  TNF signaling pathway
ocu04920  Adipocytokine signaling pathway
ocu05132  Salmonella infection
ocu05135  Yersinia infection
ocu05142  Chagas disease
ocu05145  Toxoplasmosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
ocu05203  Viral carcinogenesis
ocu05212  Pancreatic cancer
ocu05215  Prostate cancer
ocu05220  Chronic myeloid leukemia
ocu05221  Acute myeloid leukemia
ocu05222  Small cell lung cancer
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ocu05340  Primary immunodeficiency
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100328905 (IKBKG)
   04014 Ras signaling pathway
    100328905 (IKBKG)
   04064 NF-kappa B signaling pathway
    100328905 (IKBKG)
   04668 TNF signaling pathway
    100328905 (IKBKG)
   04151 PI3K-Akt signaling pathway
    100328905 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100328905 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100328905 (IKBKG)
   04621 NOD-like receptor signaling pathway
    100328905 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    100328905 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    100328905 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    100328905 (IKBKG)
   04660 T cell receptor signaling pathway
    100328905 (IKBKG)
   04658 Th1 and Th2 cell differentiation
    100328905 (IKBKG)
   04659 Th17 cell differentiation
    100328905 (IKBKG)
   04657 IL-17 signaling pathway
    100328905 (IKBKG)
   04662 B cell receptor signaling pathway
    100328905 (IKBKG)
   04062 Chemokine signaling pathway
    100328905 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100328905 (IKBKG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100328905 (IKBKG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100328905 (IKBKG)
   05203 Viral carcinogenesis
    100328905 (IKBKG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100328905 (IKBKG)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100328905 (IKBKG)
   05221 Acute myeloid leukemia
    100328905 (IKBKG)
   05220 Chronic myeloid leukemia
    100328905 (IKBKG)
   05215 Prostate cancer
    100328905 (IKBKG)
   05222 Small cell lung cancer
    100328905 (IKBKG)
  09163 Immune disease
   05340 Primary immunodeficiency
    100328905 (IKBKG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100328905 (IKBKG)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100328905 (IKBKG)
   05135 Yersinia infection
    100328905 (IKBKG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100328905 (IKBKG)
   05170 Human immunodeficiency virus 1 infection
    100328905 (IKBKG)
   05162 Measles
    100328905 (IKBKG)
   05164 Influenza A
    100328905 (IKBKG)
   05161 Hepatitis B
    100328905 (IKBKG)
   05160 Hepatitis C
    100328905 (IKBKG)
   05168 Herpes simplex virus 1 infection
    100328905 (IKBKG)
   05163 Human cytomegalovirus infection
    100328905 (IKBKG)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100328905 (IKBKG)
   05169 Epstein-Barr virus infection
    100328905 (IKBKG)
   05165 Human papillomavirus infection
    100328905 (IKBKG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100328905 (IKBKG)
   05142 Chagas disease
    100328905 (IKBKG)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100328905 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100328905 (IKBKG)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   100328905 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10 LLC1
Other DBs
NCBI-GeneID: 100328905
NCBI-ProteinID: NP_001164965
Ensembl: ENSOCUG00000007873
UniProt: B7NZR1
LinkDB
Position
X
AA seq 419 aa
MSRQPWKNQLCEMVQPSGGPAGDQDVLPEESSLGKPAMLHLPAEQGAPDALQRCLEENQE
LRDAIRQSNQMLRERCEELLRFQVSQREEKEFLLCKFQEARKLVERLNLEKLDLKRQREQ
ALQEVEHLKRCQQQMAEDKASVKAQVTSLLGELQESQSRLEAATKEREALEGRARAASEQ
ARQLESEREALQQQHSVQVDQLRMQSQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQD
YDNHIKNSMVSGERKRGMQLEDLKQQLRQAEEALVAKQEVIDKLKEEAEQHKMVMETVPV
LKAQADIYKADFQAERQAREKLAEKKELLQEQLEQLQREYSKLKASCQESARIEDLRKRH
VEVSQPPLPPAPAHHSFYLTLSNQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgagcaggcagccctggaagaaccagctgtgtgagatggtgcagcccagcggcggcccg
gccggggaccaggacgtgctgcctgaagagtcttctctggggaagccggccatgctgcat
ctgcccgcagagcagggtgctcctgacgctctccagcgctgtctggaggagaaccaagag
ctccgagatgccatccggcagagcaaccagatgctgcgggagcgctgtgaggagctgctg
cgtttccaggtcagccagagggaggagaaggagttcctcctgtgcaagttccaggaggcc
aggaaactggtggagagactgaacctggagaagctcgacctgaagaggcagagagagcag
gccctgcaggaggtggagcacctgaagagatgccagcagcagatggccgaggacaaggcc
tctgtgaaagctcaggtgacatccttgcttggggagctccaggagagccagagtcgcttg
gaggctgccactaaggagcgagaggctttggagggcagggcccgggcagccagtgagcag
gccaggcagctggagagtgagcgggaggcgctgcagcagcagcacagcgtgcaggtggac
cagctgcgcatgcagagccagagcgtggaggccgccctgcgcatggagcgccaggctgcc
tcagaggaaaagcggaagctggcccagttgcaggtggcatatcaccagctcttccaggac
tatgacaaccacatcaagaacagcatggtgagcggtgagcggaagcgggggatgcagctg
gaggatctgaagcagcagctccggcaggccgaggaggccctggtggccaagcaagaagtg
attgacaagttgaaggaggaggccgagcagcacaagatggtgatggagaccgtgccagtc
ctgaaggcccaggcggatatctacaaggcagacttccaggctgagaggcaggcccgggag
aagctggctgaaaagaaggagctgctgcaggagcagctggagcagctgcagagggagtac
agcaagctgaaggccagctgtcaggagtcagccaggattgaggatctgaggaagcggcat
gtagaggtctcccagccccctctgccccctgccccagcccaccactccttctatctgacg
ctgagcaaccagaggagaagccccccagaggagccgcctgacttctgttgtcctaagtgc
caatatcaggctcccgatatggacaccctgcagatacacgtcatggagtgcatcgagtag

KEGG   Oryctolagus cuniculus (rabbit): 100355888
Entry
100355888         CDS       T03373                                 

Gene name
CHUK
Definition
(RefSeq) conserved helix-loop-helix ubiquitous kinase
  KO
K04467  inhibitor of nuclear factor kappa-B kinase subunit alpha [EC:2.7.11.10]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01523  Antifolate resistance
ocu04010  MAPK signaling pathway
ocu04014  Ras signaling pathway
ocu04062  Chemokine signaling pathway
ocu04064  NF-kappa B signaling pathway
ocu04068  FoxO signaling pathway
ocu04150  mTOR signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04210  Apoptosis
ocu04380  Osteoclast differentiation
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04623  Cytosolic DNA-sensing pathway
ocu04625  C-type lectin receptor signaling pathway
ocu04657  IL-17 signaling pathway
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu04660  T cell receptor signaling pathway
ocu04662  B cell receptor signaling pathway
ocu04668  TNF signaling pathway
ocu04920  Adipocytokine signaling pathway
ocu05010  Alzheimer disease
ocu05132  Salmonella infection
ocu05135  Yersinia infection
ocu05142  Chagas disease
ocu05145  Toxoplasmosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
ocu05212  Pancreatic cancer
ocu05215  Prostate cancer
ocu05220  Chronic myeloid leukemia
ocu05221  Acute myeloid leukemia
ocu05222  Small cell lung cancer
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100355888 (CHUK)
   04014 Ras signaling pathway
    100355888 (CHUK)
   04064 NF-kappa B signaling pathway
    100355888 (CHUK)
   04668 TNF signaling pathway
    100355888 (CHUK)
   04068 FoxO signaling pathway
    100355888 (CHUK)
   04151 PI3K-Akt signaling pathway
    100355888 (CHUK)
   04150 mTOR signaling pathway
    100355888 (CHUK)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100355888 (CHUK)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100355888 (CHUK)
   04621 NOD-like receptor signaling pathway
    100355888 (CHUK)
   04622 RIG-I-like receptor signaling pathway
    100355888 (CHUK)
   04623 Cytosolic DNA-sensing pathway
    100355888 (CHUK)
   04625 C-type lectin receptor signaling pathway
    100355888 (CHUK)
   04660 T cell receptor signaling pathway
    100355888 (CHUK)
   04658 Th1 and Th2 cell differentiation
    100355888 (CHUK)
   04659 Th17 cell differentiation
    100355888 (CHUK)
   04657 IL-17 signaling pathway
    100355888 (CHUK)
   04662 B cell receptor signaling pathway
    100355888 (CHUK)
   04062 Chemokine signaling pathway
    100355888 (CHUK)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100355888 (CHUK)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100355888 (CHUK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100355888 (CHUK)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100355888 (CHUK)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100355888 (CHUK)
   05221 Acute myeloid leukemia
    100355888 (CHUK)
   05220 Chronic myeloid leukemia
    100355888 (CHUK)
   05215 Prostate cancer
    100355888 (CHUK)
   05222 Small cell lung cancer
    100355888 (CHUK)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100355888 (CHUK)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100355888 (CHUK)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100355888 (CHUK)
   05135 Yersinia infection
    100355888 (CHUK)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100355888 (CHUK)
   05170 Human immunodeficiency virus 1 infection
    100355888 (CHUK)
   05162 Measles
    100355888 (CHUK)
   05164 Influenza A
    100355888 (CHUK)
   05161 Hepatitis B
    100355888 (CHUK)
   05160 Hepatitis C
    100355888 (CHUK)
   05168 Herpes simplex virus 1 infection
    100355888 (CHUK)
   05163 Human cytomegalovirus infection
    100355888 (CHUK)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100355888 (CHUK)
   05169 Epstein-Barr virus infection
    100355888 (CHUK)
   05165 Human papillomavirus infection
    100355888 (CHUK)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100355888 (CHUK)
   05142 Chagas disease
    100355888 (CHUK)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100355888 (CHUK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100355888 (CHUK)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     100355888 (CHUK)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   100355888 (CHUK)
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr IKKbetaNEMObind Pkinase_fungal Kdo TBK1_ULD
Other DBs
NCBI-GeneID: 100355888
NCBI-ProteinID: XP_002718658
Ensembl: ENSOCUG00000013114
UniProt: G1T4S2
LinkDB
Position
18
AA seq 745 aa
MERPPGLRPGAGGPWEMRERLGTGGFGNVCLYQHRELDLKIAIKSCRLELSSKNRERWCH
EIQIMKKLNHANVVKACDVPEELNFLINDVPLLAMEYCSGGDLRKLLNKPENCCGLKESQ
ILSLLSDIGSGIRYLHENKIIHRDLKPENIVLQDVGGKIMHKIIDLGYAKDVDQGSLCTS
FVGTLQYLAPELFENKPYTATVDYWSFGTMVFECIAGYRPFLHHLQPFTWHEKIKKKDPK
CIFACEEMTGEVRFSSHLPQPNSLCSLIVEPMENWLQLMLNWDPQQRGGPVDLTLKQPKC
FILMDHILNLKIGHILNMTSAKIISFLLPPDESLHSLQSRIERETGINTGSQELLSETGI
SLDPRKPASQCVLDGVRGCDSYMVYLFDKSKTVYEGPFASRSLSDCVNYIVQDSKIQLPV
IQLRKVWAEAVHYVSGLKEDYSRLFQGQRAAMLSLLRYNANLTKMKNTLISASQQLKAKL
EFFHKSIQLDLERYSEQMTYGISSEKMLKAWKEMEEKAIHYAEIGVIGYLEDQIMSLHTE
IMELQKSPYGRRQGDLMESLEQRAIDLYKQLKHRPADHSYSDSTEMVKIIVHTVQSQDRV
LKELFGHLSKLLGCKQKIIDLLPKVEVALSDIKEADNTVMFMQGKRQKEIWHLLKIACTQ
SSARSLVGSSLEGTVTPQASAWLPPTSAQREHPLSCVVTPQDGDTFAQMIEENLNCLGHL
STIIREANEEQGNSMMNLDWSWLTG
NT seq 2238 nt   +upstreamnt  +downstreamnt
atggagcggcctccggggctgcggccgggtgcgggcgggccctgggagatgcgggagcgg
ctaggcaccggcggcttcgggaacgtgtgcttgtaccagcatcgggaacttgaccttaaa
atagcaattaagtcttgtcgcctagagctaagttccaaaaacagagaacggtggtgccat
gaaatccagatcatgaaaaagttgaatcatgccaatgttgtaaaggcctgtgatgttcct
gaggaattgaattttttgattaatgatgtgcctcttctagcaatggagtactgttctgga
ggagatcttcggaagctactcaacaaaccagaaaattgttgtggacttaaagaaagccag
atactttctttattaagtgatatagggtctgggattcgatatttgcatgaaaacaaaatt
atacatcgagatctaaaacctgaaaacatagttcttcaggatgttggtggaaagataatg
cataaaataattgatctgggatatgccaaagatgttgatcaaggaagtctatgtacatct
tttgtgggaacactgcagtatttggccccagagctttttgagaataagccctacacagca
actgttgattactggagctttgggaccatggtctttgaatgtattgctggatataggcct
tttctacatcatctgcagccgtttacctggcatgagaagattaagaagaaggatccaaag
tgtatatttgcatgtgaagagatgacaggagaagttcggtttagtagccatttgcctcaa
ccaaatagcctttgtagtttaatagtagaacctatggaaaactggctacagttgatgctg
aattgggaccctcagcagagagggggacctgttgaccttactttgaagcagccaaaatgt
ttcatcttaatggatcacattctgaatttgaagatagggcacatcctaaacatgacttct
gcaaagataatttcttttctgttaccacctgatgaaagtcttcattcactacagtctcgt
attgagcgtgaaactggaataaatactggttctcaagagcttctttcagagacaggaatt
tctctggatcctcgaaaaccagcctctcagtgtgttctagatggagttagaggctgtgat
agctatatggtttatttgtttgataaaagtaaaactgtatatgaagggccatttgcttcc
agaagtttatctgattgtgtaaattatattgtacaggacagcaaaatacaacttccagtt
atacagctacgtaaagtatgggctgaagcagtgcactatgtgtctgggctgaaggaagat
tacagcaggctctttcagggacaaagagcagcaatgttaagccttcttagatataatgct
aacttgacaaaaatgaagaacactttgatctcggcatcacagcaactgaaagctaaattg
gaattttttcacaaaagcattcagcttgacttggagagatacagcgaacaaatgacatat
gggatatcttcagaaaaaatgctaaaggcatggaaagaaatggaagaaaaggccatccac
tatgctgagatcggtgtcattgggtacctggaggatcagattatgtccttgcacactgaa
atcatggagctacagaagagcccctacggaagacgtcagggagacttgatggaatctctg
gaacagcgtgccattgatctttataagcagttaaagcacagacctgcagatcattcctac
agcgacagcacagagatggtgaagatcattgtgcatactgtgcagagtcaggaccgagtt
cttaaggagctgtttggccatctaagcaagttgttgggctgtaagcagaagattattgat
ctactccccaaggtggaagtggccctcagtgacatcaaagaagctgacaatactgtcatg
tttatgcaaggaaagaggcagaaagaaatatggcatctccttaaaattgcctgtacacag
agttctgcccggtctcttgtaggatccagtttagagggcacagtaacccctcaggcatca
gcatggctgcccccaacttcagcacaacgtgaacatcctctgtcatgcgtggtaactcct
caagatggggacacttttgcacaaatgatagaagaaaatttgaattgtcttggccattta
agcactattatccgtgaagcaaatgaggaacagggcaatagtatgatgaatctagattgg
agttggttaacaggatga

KEGG   Oryctolagus cuniculus (rabbit): 100356401
Entry
100356401         CDS       T03373                                 

Gene name
IKBKB
Definition
(RefSeq) inhibitor of nuclear factor kappa B kinase subunit beta
  KO
K07209  inhibitor of nuclear factor kappa-B kinase subunit beta [EC:2.7.11.10]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01523  Antifolate resistance
ocu04010  MAPK signaling pathway
ocu04014  Ras signaling pathway
ocu04062  Chemokine signaling pathway
ocu04064  NF-kappa B signaling pathway
ocu04068  FoxO signaling pathway
ocu04150  mTOR signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04210  Apoptosis
ocu04380  Osteoclast differentiation
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04623  Cytosolic DNA-sensing pathway
ocu04625  C-type lectin receptor signaling pathway
ocu04657  IL-17 signaling pathway
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu04660  T cell receptor signaling pathway
ocu04662  B cell receptor signaling pathway
ocu04668  TNF signaling pathway
ocu04722  Neurotrophin signaling pathway
ocu04910  Insulin signaling pathway
ocu04920  Adipocytokine signaling pathway
ocu04930  Type II diabetes mellitus
ocu04931  Insulin resistance
ocu04932  Non-alcoholic fatty liver disease
ocu05010  Alzheimer disease
ocu05132  Salmonella infection
ocu05135  Yersinia infection
ocu05142  Chagas disease
ocu05145  Toxoplasmosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
ocu05206  MicroRNAs in cancer
ocu05212  Pancreatic cancer
ocu05215  Prostate cancer
ocu05220  Chronic myeloid leukemia
ocu05221  Acute myeloid leukemia
ocu05222  Small cell lung cancer
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100356401 (IKBKB)
   04014 Ras signaling pathway
    100356401 (IKBKB)
   04064 NF-kappa B signaling pathway
    100356401 (IKBKB)
   04668 TNF signaling pathway
    100356401 (IKBKB)
   04068 FoxO signaling pathway
    100356401 (IKBKB)
   04151 PI3K-Akt signaling pathway
    100356401 (IKBKB)
   04150 mTOR signaling pathway
    100356401 (IKBKB)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100356401 (IKBKB)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100356401 (IKBKB)
   04621 NOD-like receptor signaling pathway
    100356401 (IKBKB)
   04622 RIG-I-like receptor signaling pathway
    100356401 (IKBKB)
   04623 Cytosolic DNA-sensing pathway
    100356401 (IKBKB)
   04625 C-type lectin receptor signaling pathway
    100356401 (IKBKB)
   04660 T cell receptor signaling pathway
    100356401 (IKBKB)
   04658 Th1 and Th2 cell differentiation
    100356401 (IKBKB)
   04659 Th17 cell differentiation
    100356401 (IKBKB)
   04657 IL-17 signaling pathway
    100356401 (IKBKB)
   04662 B cell receptor signaling pathway
    100356401 (IKBKB)
   04062 Chemokine signaling pathway
    100356401 (IKBKB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100356401 (IKBKB)
   04920 Adipocytokine signaling pathway
    100356401 (IKBKB)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100356401 (IKBKB)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100356401 (IKBKB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100356401 (IKBKB)
   05206 MicroRNAs in cancer
    100356401 (IKBKB)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100356401 (IKBKB)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100356401 (IKBKB)
   05221 Acute myeloid leukemia
    100356401 (IKBKB)
   05220 Chronic myeloid leukemia
    100356401 (IKBKB)
   05215 Prostate cancer
    100356401 (IKBKB)
   05222 Small cell lung cancer
    100356401 (IKBKB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100356401 (IKBKB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100356401 (IKBKB)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100356401 (IKBKB)
   04932 Non-alcoholic fatty liver disease
    100356401 (IKBKB)
   04931 Insulin resistance
    100356401 (IKBKB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100356401 (IKBKB)
   05135 Yersinia infection
    100356401 (IKBKB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100356401 (IKBKB)
   05170 Human immunodeficiency virus 1 infection
    100356401 (IKBKB)
   05162 Measles
    100356401 (IKBKB)
   05164 Influenza A
    100356401 (IKBKB)
   05161 Hepatitis B
    100356401 (IKBKB)
   05160 Hepatitis C
    100356401 (IKBKB)
   05168 Herpes simplex virus 1 infection
    100356401 (IKBKB)
   05163 Human cytomegalovirus infection
    100356401 (IKBKB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100356401 (IKBKB)
   05169 Epstein-Barr virus infection
    100356401 (IKBKB)
   05165 Human papillomavirus infection
    100356401 (IKBKB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100356401 (IKBKB)
   05142 Chagas disease
    100356401 (IKBKB)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100356401 (IKBKB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100356401 (IKBKB)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     100356401 (IKBKB)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   100356401 (IKBKB)
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr IKKbetaNEMObind Pkinase_fungal Kdo ubiquitin APH YrbL-PhoP_reg TBK1_ULD Med20 Glyco_hydro_65m
Other DBs
NCBI-GeneID: 100356401
NCBI-ProteinID: XP_002720840
Ensembl: ENSOCUG00000007141
UniProt: G1SSF8
LinkDB
Position
Un
AA seq 756 aa
MSWSPSLPTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCL
EIQIMRRLNHPNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREG
AILTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQGSLCT
SFVGTLQYLAPELLEQQKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQWHSKVRQKSE
MDIVVSEDLNGAVKFSSSLPYPNNLNSILAQRLEKWLQLMLMWHPRQRGTDPTYGPNGCF
KALDDILNLKLVHILNMVTGTVHSYPVSEDESLQSLKARIQSDTGISEQDQELLQEAGLA
LIPDKPATQCISDGKLNEGRTLDMDLVFLFDNSKVAYETQISPRPQPESVSCILQEPKRN
LPFFQLRKVWGQVWHSIQTLKEDCNRLQQGQRAAMMNLLRNNSCLSKMKNSMASISQQLK
AKLDFFKTSIQIDLEKYSEQTEFGITSDKLLLAWREMEQAVELCGREDEVKHLVERMMAL
QTDIVDLQRSPMGRKQGGTLDDLEEQARELYRRLREKPRDQRTDGDSQEMVRLLLQAIQG
FEKKVRVIYTQLSKTVVCKQKALELLPKVEEVVSLMNEDEKTVVRLQEKRQKELWNLLKI
ACSKVRGPVSGSPDSMNASRLSHPGQLMSQPSPASDSLPEPVKKSEDLVAEAHSLCTQLE
SAMQDTVKEQDQSFMTLDWSWLQPEEEEQSRPEQAV
NT seq 2271 nt   +upstreamnt  +downstreamnt
atgagctggtcgccttcgctgccaacccagacctgcggggcctgggaaatgaaagaacgc
ctgggaactgggggcttcggaaacgtcatccgctggcacaatcaggagacaggcgagcag
atcgccatcaagcagtgccggcaggagctgagcccacggaaccgagagcgctggtgtctt
gagatccagatcatgagaaggctgaaccaccctaacgtggtggccgcccgggatgtcccc
gaggggatgcagaacttggcgcccaacgacctgccgctgctggccatggagtactgccaa
ggaggagacctccgcaagtacctgaaccagtttgagaactgctgcggcctgcgggaagga
gccatcctcaccttgctgagcgacattgcctctgcgcttagatacctccatgagaacaga
atcatccaccgagatctgaagccggagaacattgttctgcagcaaggagagcaaagatta
atacacaaaatcattgacctgggatacgccaaggaactggatcagggcagcctttgtacc
tcctttgtggggaccctgcagtacctggccccggaactgctggagcagcagaagtacacg
gtgaccgtggactactggagcttcggcaccttggccttcgagtgcatcaccggcttcaga
cccttccttcccaactggcagcctgtgcagtggcactcgaaagtccggcagaagagtgag
atggacattgtcgttagtgaagacttgaacggtgcagtgaagttttccagctctttaccc
taccccaacaatcttaacagcatactagcccagcgcctggaaaagtggctgcagctgatg
ctgatgtggcatccccggcagaggggcacggatcccacgtacgggcccaacggctgcttc
aaggccctggacgacatcttaaacctaaagctggttcacatcctgaacatggtcacgggc
accgttcacagctacccagtgtcagaggacgagagcctgcagagcttaaaggccagaatc
cagagcgacacgggcatctccgaacaggaccaggagctcctgcaggaggcaggtctggcc
ttgatccccgacaagcccgccacgcagtgcatttctgacggcaagctaaatgaaggccgc
accctggacatggatcttgtttttctctttgacaacagcaaagtcgcctatgagactcag
atctccccgcggccccagcctgagagcgtcagctgtatccttcaggagcccaagaggaat
ctccctttcttccagctgaggaaggtgtggggccaggtctggcacagcatccagaccctg
aaggaggactgcaaccggctgcagcagggccagcgagctgccatgatgaacctcctccgt
aataacagctgcctctccaagatgaagaattccatggcttccatatcccagcagctcaag
gccaagttggacttctttaaaaccagcatccagatcgacctggagaagtacagcgagcaa
accgagttcgggatcacatcagataagctgctgctggcctggagggaaatggaacaggcc
gtggagctgtgtgggcgggaggacgaagtgaagcatcttgtggagcggatgatggccctg
cagaccgacatcgtggacctgcagaggagccccatgggccggaagcaggggggcacgctg
gacgacttagaggagcaagccagggagctttacaggcggctgcgagaaaaaccacgagac
cagcgcacggacggcgacagccaggagatggtgcggctgctgctgcaggccatccaaggc
tttgagaagaaagtgcgggtgatttacacgcagctcagcaagaccgtggtctgcaagcag
aaggcgctggagctgctgcccaaggtggaggaggtggtgagcttgatgaacgaggacgag
aagaccgtggttcggctgcaggagaagcggcagaaggagctgtggaacctcctgaagatt
gcctgtagcaaggtccgcggtcctgtcagcggaagtccggacagcatgaacgcgtctcgg
ctcagccaccctggtcagctcatgtctcagccttcccctgcctccgacagcctgcctgag
ccggtcaagaagagtgaagacctggtggctgaagcgcattctctctgcacccagctggaa
agcgcaatgcaggacaccgtgaaggagcaggaccagagtttcatgactcttgactggagc
tggttacagccggaggaggaggaacagagcaggccggagcaggcggtgtga

DBGET integrated database retrieval system