KEGG   Oryctolagus cuniculus (rabbit): 100337711
Entry
100337711         CDS       T03373                                 

Gene name
RRM2B
Definition
(RefSeq) ribonucleotide reductase regulatory TP53 inducible subunit M2B
  KO
K10808  ribonucleoside-diphosphate reductase subunit M2 [EC:1.17.4.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00230  Purine metabolism
ocu00240  Pyrimidine metabolism
ocu00480  Glutathione metabolism
ocu00983  Drug metabolism - other enzymes
ocu01100  Metabolic pathways
ocu04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100337711 (RRM2B)
   00240 Pyrimidine metabolism
    100337711 (RRM2B)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    100337711 (RRM2B)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100337711 (RRM2B)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100337711 (RRM2B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ocu03400]
    100337711 (RRM2B)
Enzymes [BR:ocu01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     100337711 (RRM2B)
DNA repair and recombination proteins [BR:ocu03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    100337711 (RRM2B)
SSDB
Motif
Pfam: Ribonuc_red_sm
Other DBs
NCBI-GeneID: 100337711
NCBI-ProteinID: XP_008254026
Ensembl: ENSOCUG00000008545
UniProt: A0A5F9D0E6
LinkDB
Position
3
AA seq 346 aa
MGDPERPEAARPEQGEKLSPDTNEDEEPLLKKSSRRFVIFPIQYPDIWKMYKQAQASFWT
AEEVDLSKDLPHWNRLTSDEKYFISHVLAFFAASDGIVNENLVERFSQEVQVPEARCFYG
FQILIENVHSEMYSLLIDTYIRDPKKREFLFNAIETMPYVKKKADWALRWIADRKSTFGE
RVVAFAAVEGIFFSGSFAAIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFQYLVNK
PSEERVREIIVNAVEIEQEFLTEALPVGLIGMNCILMKQYIEFVADRLLMELGFSKVFQA
ENPFDFMENISLEGKTNFFEKRVSEYQRFAVMAETTDNVFTLDADF
NT seq 1041 nt   +upstreamnt  +downstreamnt
atgggcgacccggaaaggccggaagcggccaggcccgagcagggtgagaagttatctcca
gataccaacgaagatgaagagccgctgctgaagaagagttcccgccgcttcgtcatcttt
ccgatccagtaccccgacatatggaaaatgtacaagcaagcacaggcatccttctggact
gcagaagaggttgacttatcaaaggatctccctcactggaacagacttacatcagatgag
aaatattttatctctcatgtcttagccttttttgcagccagtgatggaattgtaaatgaa
aatttggtggagcgctttagtcaggaggtgcaggttccagaggctcgctgtttctatggc
ttccaaatcctcattgagaatgtccactcagagatgtacagtttgctaatagacacttac
atcagagatcccaagaaaagggaatttttatttaatgcaattgaaacaatgccatatgtt
aagaaaaaagcagattgggccctgcgatggatagcagatagaaaatctacttttggggaa
agggtggtggcctttgctgctgtagaagggattttcttctcgggatcttttgctgctata
ttctggctaaagaagagaggtctgatgcctggactcactttttccaatgagctcatcagc
agagatgaaggacttcactgtgactttgcttgcctgatgtttcagtatttagtaaataag
ccttcagaagagagggtcagagagatcattgttaatgctgtcgaaattgagcaggagttt
ttaacagaagccttgccggttggcctcattggaatgaactgtattttgatgaagcagtac
attgagtttgtagctgacaggttactcatggaacttggattctcaaaggttttccaggca
gaaaatccttttgatttcatggaaaacatttctttagaagggaaaacaaatttctttgag
aaacgagtttcagagtatcagcgttttgcagttatggcggaaaccacagataatgtcttc
accttagacgcagatttttaa

KEGG   Oryctolagus cuniculus (rabbit): 100346325
Entry
100346325         CDS       T03373                                 

Gene name
RRM2
Definition
(RefSeq) ribonucleotide reductase regulatory subunit M2
  KO
K10808  ribonucleoside-diphosphate reductase subunit M2 [EC:1.17.4.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00230  Purine metabolism
ocu00240  Pyrimidine metabolism
ocu00480  Glutathione metabolism
ocu00983  Drug metabolism - other enzymes
ocu01100  Metabolic pathways
ocu04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100346325 (RRM2)
   00240 Pyrimidine metabolism
    100346325 (RRM2)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    100346325 (RRM2)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100346325 (RRM2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100346325 (RRM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ocu03400]
    100346325 (RRM2)
Enzymes [BR:ocu01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     100346325 (RRM2)
DNA repair and recombination proteins [BR:ocu03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    100346325 (RRM2)
SSDB
Motif
Pfam: Ribonuc_red_sm
Other DBs
NCBI-GeneID: 100346325
NCBI-ProteinID: XP_017193792
Ensembl: ENSOCUG00000005820
LinkDB
Position
Un
AA seq 389 aa
MLSVRVPLATLADQQQLQLSPLKGLSLADKENTPPSLSGTRVLASKTARRIFQEPAEPKP
PAPAAGVEDEPLLRENPRRFVIFPIEYHDIWNMYKKAEASFWTAEEVDLSKDIQHWEALK
EEERYFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYSLLI
DTYIKDPKEREFLFNAIETMPCVKKKADWALRWIGDKEATYGERVVAFAAVEGIFFSGSF
ASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLVHKPSEQRVQEIIVNAVRIE
QEFLTEALPVKLIGMNCALMKQYIEFVADRLLLELGFSKVFRVENPFDFMENISLEGKTN
FFEKRVGEYQRMGVMSSPTENSFTLDADF
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgctctccgtccgcgtcccgctcgccaccctcgccgaccagcagcagctgcagctgtcg
ccgctgaaggggctcagcctcgccgacaaggagaacacgcccccgagcctcagcgggacc
cgcgtgctggccagcaagaccgccaggaggatcttccaggagcccgcggagccgaagccc
ccggcccctgccgctggcgtggaggacgagcccctgctgcgggagaacccgcgccgcttc
gtgatcttccccatcgagtaccacgacatctggaacatgtacaagaaagccgaggcgtcc
ttttggaccgcggaggaggtggacctctccaaggacatccagcactgggaagccctgaag
gaggaggagagatacttcatatcccacgtgctggctttctttgcggcaagcgacggcatc
gtcaatgagaacctggtggagcggttcagccaggaggttcagatcactgaagcccgctgt
ttctacggcttccaaatcgccatggaaaacatacactccgagatgtacagcctcctgatt
gacacgtacattaaagatcccaaggaaagggaatttctctttaatgccattgagacgatg
ccttgtgtcaagaagaaggcggattgggccttgcgttggattggggacaaagaggcgacc
tacggagaacgcgtcgtagcctttgctgcggtggaaggcatcttcttctctggttctttt
gcgtcgattttctggctcaagaaacgaggactgatgcccgggcttacgttctccaatgag
cttattagcagggatgagggtttgcactgcgactttgcctgcctgatgttcaagcacctg
gtccacaagccgtcggagcagagagtccaggagatcatcgtcaacgctgtgaggatagag
caggagttcctcaccgaggccttgcccgtgaagctcatcggcatgaactgcgccttgatg
aagcagtacatcgagttcgtggccgacaggctcctgctggagctcggctttagcaaggtg
ttcagagtggagaacccgtttgacttcatggagaacatttcactggaagggaagaccaac
ttctttgagaagagagtgggcgagtatcagaggatgggggtgatgtcgagcccgaccgag
aactcctttaccctggatgccgacttctaa

DBGET integrated database retrieval system