KEGG   Oryctolagus cuniculus (rabbit): 100337807
Entry
100337807         CDS       T03373                                 

Gene name
MSH3
Definition
(RefSeq) mutS homolog 3
  KO
K08736  DNA mismatch repair protein MSH3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01524  Platinum drug resistance
ocu03430  Mismatch repair
ocu05200  Pathways in cancer
ocu05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    100337807 (MSH3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100337807 (MSH3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100337807 (MSH3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100337807 (MSH3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ocu03400]
    100337807 (MSH3)
DNA repair and recombination proteins [BR:ocu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     100337807 (MSH3)
SSDB
Motif
Pfam: MutS_V MutS_III MutS_II MutS_I MutS_IV CCDC85
Other DBs
NCBI-GeneID: 100337807
NCBI-ProteinID: XP_008260099
Ensembl: ENSOCUG00000016921
LinkDB
Position
11
AA seq 1125 aa
MLAMPRGKRASGGLAASGPAPARQAVLSRFFQAKESRKPTPPATDAAEKASPASAAPPAS
TSPPRRPPRAGSLEQAAEASSKKRSQEPEGPVSKKARPVGEQEGGSGSGSAGHPEPKQCL
SSGLVLKSLEKLRKFCCDSAPPQTRVQTERLRGGCAVLPKCTDYDDLDLLRARNAAASED
SGSQARQKDKTFSDLSSFGSSQASHEDGQQACESKPLNKRSKSVYTPLELQFLEVKRQHQ
DAVLCVECGYKYRFFGEDAEIAARELNIYCHLDHNFLTASIPTHRLFVHVRRLVAKGYKV
GVVKQTETAALKAVGDNKSSLFSRKLTALYTKSTLIGEDVNPLIKLDGAMNVDEIMTDAS
SNYLLCICENKEKAKDKKKGSIFIGVVGVQPATGEVVYDSFQDSASRSELETRISALQPV
ELLLPSHLSEQTERLIHRATAVSVRDDRMRVERMEDVHFEYSHAFQMVTEFYAKDETQGS
QSLSGILNLEKPVVCSLAAVIRYLKEFNLEKMLSKPENFKQLSSEVEFMTINGTTLRNLE
ILQNQTDMKTKGSLFWVLDHTKTSFGRRKLKKWVTQPLLKLRDINARLDAVSEVLHSESS
VFGQIENHLNKLPDIERGLCSIYHKKCSTQEFFLIVKTLCHLKSEFQALVPAVNSQVHSD
LLRTCALDIPELLRPAERYLQVLNEQAAKIGDKTELFKDLSDFPLIKKRKNEIQEVTEKI
QVHLQEIRKILKNPSAQYVTVSGQEFMIEIKNSSLSCIPADWIKVGSTKAVSRFHSPFIV
ENYRRLNQLREQLALDCGAEWLGFLETFSGHHDSLCKAVHHLATVDCIFSLTKVAKQGNY
CRPALQEERKIIIKNGRHPVIDVLLGEQDQYVPNSTNLSGDAERVMIITGPNMGGKSSYI
KQVALIAVMAQIGSYVPAEEATLGIVDGIFTRMGAADNIYKGRSTFMEELTDTAEIIRQA
TPQSLVILDELGRGTSTHDGIAIAYATLEYFIRDVQSLTLFVTHYPPVCELEKHYSQQVG
NYHMGFLVTEDESKQDPGGEEPVPDFVTFLYQITQGVAARSYGLNVAKLADVPGEVLRKA
ARKSQELEGLVNAKRKRLKYFTKVWTIHSAEDLRNWTAECEEEGL
NT seq 3378 nt   +upstreamnt  +downstreamnt
atgcttgcgatgcctcgcgggaagcgcgcctcaggcggccttgccgcttccggccctgcg
ccggcccggcaagcggtgctgagccgattctttcaggctaaggagagccggaagcccacg
ccgcccgccactgacgcagccgaaaaggcgagccccgcctccgcagcgcccccggcgtcc
acgtccccgcctcggcggccgccgcgcgcgggcagtttggagcaggccgcggaagcttcc
agcaaaaagagatctcaggagcccgaggggcctgtgagcaagaaagcgcggcctgtgggg
gaacaggaaggaggaagtggctccggctctgccggccacccagagccgaagcagtgcctg
agttcggggctcgttttgaagtctctggagaaactcaggaaattctgctgcgattccgcg
ccgcctcagactcgagtccagacagaacgccttcggggggggtgtgcggtcctgccgaag
tgcaccgattatgatgacctcgatctcctgcgtgccaggaatgccgccgcttctgaggat
tccggctctcaggcccgtcagaaggacaagacattttctgatctcagttcttttggatca
tcacaagcgagccacgaagatggacagcaagcgtgtgagtctaagcccctgaacaagcgg
tccaagagcgtctacaccccgctggagctgcagttcctggaggtgaagcggcagcaccag
gacgcggttctgtgcgtggagtgcggctataagtacaggttcttcggggaggatgcagag
attgcagctcgggagctcaacatttattgccacttggatcacaacttcctgacagccagc
atccctacccacaggctgtttgtccacgtgcgccgtctcgtggccaaaggatacaaggtg
ggagttgtgaagcagactgaaactgcagcactaaaggccgttggggacaacaaaagctca
ctgttttcccgaaaactgactgctctttataccaaatccacactcattggagaagatgtg
aatcctctaatcaaactggatggtgctatgaatgtcgatgagataatgactgatgcttct
tccaactatcttctgtgtatctgtgaaaataaagaaaaggctaaggacaagaagaaagga
agcattttcattggcgttgtgggagtgcagcctgccaccggcgaggtcgtgtacgacagc
ttccaggactccgcttcccgttcagagctggagacgcggatctcagccctgcagccagtg
gagctgctgctgccctcacacctgtccgagcaaaccgagaggctcattcacagagctaca
gcggtcagtgtgcgggatgacagaatgcgcgtggaaaggatggaggatgttcactttgag
tacagccacgcgttccagatggttaccgagttttatgcaaaggatgaaacccaaggctct
caaagtctttctggcatccttaacctggagaagcctgtggtctgctctttggctgctgta
ataagatacctcaaagaatttaacttggaaaagatgctttccaaacccgagaattttaaa
cagctgtcaagtgaagtggaatttatgacaattaacgggacgacgttaaggaatttggaa
atcctgcagaatcagactgatatgaaaacgaaagggagcttattctgggtcttagaccac
acgaaaacttcatttggaagacggaagttaaagaagtgggtgacccagccactccttaaa
ttgagggacataaatgcccgactggatgctgtatctgaagttctccattcagaatctagt
gtgtttggtcagatagaaaatcatctaaataaactgcctgacatcgagagaggactctgt
agcatttatcacaaaaaatgttctacccaagagttcttcttgattgtcaaaactctgtgt
cacctgaagtcagaatttcaagcgttagtacctgctgtgaattcccaagttcactcagac
ctgctgcggacgtgcgctttggacattccagagctgctcaggccagcggagcgttacttg
caggtccttaatgaacaagccgccaaaattggggacaaaactgaattattcaaagacctt
tctgacttccccttaataaaaaagaggaagaatgaaattcaagaagtcacagaaaagatc
caagtacatttacaagaaatccgaaaaatattaaaaaatccttccgcacagtatgtgaca
gtatcgggacaggagtttatgattgagataaagaattcttctctatcttgtataccagct
gattggattaaggttggaagcacaaaagctgtgagccgctttcactctccttttattgta
gaaaattacagacgactgaatcagctccgagagcagctcgcccttgactgcggtgctgag
tggcttggttttctagagacgttcagtggacatcatgactccctgtgtaaggcggtgcat
cacctagcaactgttgactgcattttctccctgaccaaggtcgctaagcaaggaaattac
tgcagaccagctctacaagaagaaaggaaaatcataataaaaaatggaaggcatcctgtg
attgatgtgttgctcggcgagcaggatcagtacgttcccaatagtacgaatctgtcaggg
gacgcagagagagtgatgatcatcactggtccaaacatgggcggaaagagctcctacatc
aaacaggttgcactgatcgccgtcatggctcagatcggctcctacgttcctgccgaggaa
gccacgcttgggatcgtggatggcattttcacgagaatgggtgctgcagacaacatatat
aaaggacggagcacatttatggaagaactgacagacacagcggaaattatccgccaagca
acaccgcagtccttggtcatcctggatgagctgggaagagggaccagcactcacgatgga
atcgccattgcttatgctactctggagtattttattagagatgtgcagtctctaaccctg
tttgtcacccattatccaccagtttgtgaactggagaaacattactcacagcaggtgggc
aattaccacatgggcttcttggtgaccgaagatgaaagcaaacaggacccaggtggagag
gaaccagtccctgattttgtcacgtttctttaccaaatcacccaaggcgttgccgccagg
agttacgggctgaatgtggccaagctggcagacgttcctggcgaggtcttacggaaagca
gcccgcaagtcacaggagctggaagggctggtgaacgcgaaaaggaaaaggctaaagtat
tttacaaaagtatggacaatacacagtgcagaagatctgcgaaactggacagccgagtgc
gaagaggaaggactatag

DBGET integrated database retrieval system