KEGG   Oryctolagus cuniculus (rabbit): 100337912
Entry
100337912         CDS       T03373                                 

Gene name
MLH1
Definition
(RefSeq) mutL homolog 1
  KO
K08734  DNA mismatch repair protein MLH1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01524  Platinum drug resistance
ocu03430  Mismatch repair
ocu03460  Fanconi anemia pathway
ocu05200  Pathways in cancer
ocu05210  Colorectal cancer
ocu05213  Endometrial cancer
ocu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    100337912 (MLH1)
   03460 Fanconi anemia pathway
    100337912 (MLH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100337912 (MLH1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100337912 (MLH1)
   05226 Gastric cancer
    100337912 (MLH1)
   05213 Endometrial cancer
    100337912 (MLH1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100337912 (MLH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ocu03400]
    100337912 (MLH1)
DNA repair and recombination proteins [BR:ocu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    MutL homologs
     100337912 (MLH1)
SSDB
Motif
Pfam: Mlh1_C DNA_mis_repair HATPase_c_3 HATPase_c
Other DBs
NCBI-GeneID: 100337912
NCBI-ProteinID: XP_002716213
Ensembl: ENSOCUG00000002240
UniProt: G1SH41
LinkDB
Position
14
AA seq 758 aa
MSLVAGVIRRLDETVVNRIAAGEVIQRPANAIKEMIENCLDAKSTSIQVVVKEGGLKLIQ
IQDNGTGIRKEDLDIVCERFTTSKLQSFEDLASISTYGFRGEALASISHVAHVTITTKTS
DGKCAYRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEYGKILEVV
GRYSIHNSGISFSVKKQGETVADVRTLPGATTVDNIRSIFGNAVSRELIEVGCEDPTLAF
KMNGYISNANYSVKKCIFLLFINHRLVESTSLKKAIETVYAAYLPKNTHPFLYLSLEISP
QNVDVNVHPTKHEVHFLHEESILARVQQHIESKLLGSNSSRMYFTQTLLPGLAGPSGDVI
KPAAGVASASASGSGDRVYAHHMVRTDSREQKLDAFLQPVSQPLSSQPPATVPEGQTDGS
SGGAGQPDEEMPELPAPAEAAAETRSLEGDVTRGTLETSEKRGPSSSPGLPRKRCREDSA
VEMMEDESRKEMTAACTPRRRIINLTSVLSLREEINERGHETLREMLRDSSFVGCVNPQW
ALAQHQTKLYLLNTTKLSEELFYQILIYDFANFGVLRLSEPAPLFDLAMLALDSPESGWT
EEDGPKEGLAEYIVEFLKKKAEMLADYFSLEIDEEGNLTGLPLLIDNYVPPLEGLPLFIL
RLATEVNWDEEKECFESLSKECAMFYSVRKQYISEESTLSGQQSKAAGSSVNSWKWTVEH
VVYKAFRSHLLPPKHFTEDGNILQLANLPDLYRVFERC
NT seq 2277 nt   +upstreamnt  +downstreamnt
atgtcgctcgtggcgggggttatccggcggctggacgagacagtggtgaaccgcatcgcg
gcgggggaagttatccagcggccggctaatgccatcaaagaaatgattgagaactgttta
gatgcaaaatccacgagtattcaagttgttgttaaagaaggaggcctgaagttgattcag
atccaagacaatggcactggaatcaggaaggaagatctggatattgtgtgtgagaggttc
actacaagtaagctgcagtcctttgaggatttagccagcatctctacctacggctttcgg
ggcgaggctttggccagcataagccacgtggctcatgttactattaccaccaagaccagt
gatggaaagtgtgcatacagagcgagttactcagatggaaagctgaaagctcctcctaag
ccatgtgccggcaatcaggggacgcagatcacggtggaggaccttttttacaacatagcc
acaaggaggaaagctttaaaaaatccaagcgaagagtatgggaagattttggaagttgtt
ggcaggtattcaatacacaattcaggcattagtttttcggttaaaaaacaaggagagacc
gtggctgatgtccgaacgttacctggcgccacaactgtggacaatattcgctccatcttt
ggaaacgctgttagtcgagagctgatagaagttgggtgtgaggatccaacccttgctttc
aaaatgaatggctacatatccaacgcgaactactcagtgaagaagtgtatcttcttgctg
ttcatcaaccatcgcctggtagaatcgacctctttgaagaaagccatagaaacagtgtat
gcagcgtatttgcccaaaaacacacacccgttcctgtacctcagtttggaaatcagcccc
cagaatgtggatgtcaacgtgcaccctacaaaacacgaagttcacttcctgcacgaggag
agcatcctggcgcgggtgcagcagcacattgagagcaagctcctgggctccaactcctcc
cgcatgtacttcacccagactttgctgccaggacttgctggcccctctggggacgtgatc
aaacccgcagcaggagtggcctctgcctctgcctccggaagtggtgacagggtctacgcc
caccacatggtccgcacagattcgcgggaacagaagctcgatgccttcctgcagcccgtg
agccagccactgtcgagtcagcctccggccactgtcccggagggtcagacagacggttcc
agtggcggggctgggcagccagacgaggagatgccggaactcccggcccctgctgaggca
gccgctgagactcggagcttggagggggatgtgacaagggggactttggaaacatcagag
aagagaggacccagctccagcccaggcctccccagaaagagatgtcgagaagattctgct
gtggaaatgatggaagatgagtcccggaaggaaatgacagcagcctgcacgccccggagg
agaatcattaacctcaccagcgttttgagtctccgtgaagaaattaatgagcggggacat
gagactctccgggagatgctgcgtgactcctccttcgtgggctgtgtgaatcctcagtgg
gccctggcgcagcatcagaccaagctgtaccttctcaacaccaccaaactgagtgaagag
ctgttctaccagatactcatttatgattttgccaattttggtgttctgagattatcggag
ccggctccgctctttgacctcgccatgctggccttggacagtcctgagagtggctggacg
gaggaggatggccccaaggaggggctcgccgagtacatcgtggagttcctcaagaagaag
gccgagatgcttgcagactacttttccctggaaattgacgaggaagggaacctcactgga
ttacccctgctgatcgacaactatgtgccccctctggagggcctgcccctcttcatcctt
cgactggccactgaggtgaactgggatgaagaaaaggaatgctttgagagcctcagtaaa
gaatgtgctatgttctactcggtccgcaagcagtacatatctgaggagtcgaccctgtca
ggccagcagagcaaagccgctggctccagcgtgaactcctggaagtggaccgtggaacac
gtcgtgtacaaggccttccgctcccacctgctgcccccgaaacacttcacggaggacgga
aacatcctgcagctcgctaacctgcccgacctatacagagtctttgagaggtgctga

DBGET integrated database retrieval system