KEGG   Oryctolagus cuniculus (rabbit): 100338333
Entry
100338333         CDS       T03373                                 

Gene name
TIAM1
Definition
(RefSeq) T-cell lymphoma invasion and metastasis 1
  KO
K05731  T-lymphoma invasion and metastasis-inducing protein 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04014  Ras signaling pathway
ocu04015  Rap1 signaling pathway
ocu04024  cAMP signaling pathway
ocu04062  Chemokine signaling pathway
ocu04530  Tight junction
ocu04810  Regulation of actin cytoskeleton
ocu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100338333 (TIAM1)
   04015 Rap1 signaling pathway
    100338333 (TIAM1)
   04024 cAMP signaling pathway
    100338333 (TIAM1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100338333 (TIAM1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100338333 (TIAM1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100338333 (TIAM1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100338333 (TIAM1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:ocu04990]
    100338333 (TIAM1)
Domain-containing proteins not elsewhere classified [BR:ocu04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   100338333 (TIAM1)
SSDB
Motif
Pfam: RhoGEF Tiam_CC_Ex PH RBD PH_9 PDZ PDZ_2 PDZ_6 PH_11
Other DBs
NCBI-GeneID: 100338333
NCBI-ProteinID: XP_002716851
Ensembl: ENSOCUG00000016524
UniProt: G1TBU5
LinkDB
Position
14
AA seq 1592 aa
MGNAESQTVAHEFYGEKHASLGRKHTSRSLRLSHKTRRTRHASSGKVIHRNSEVSTRSSS
TPSIPQSLAENGLEPFSQEGTLEDFGSPIWVDRVDMGLRPVSYTDSSVTPSVDSSIVLTA
ASVQSMPDSEESRLYGDDATYLAEGGRRQHLFTSNGPAFMETASFKKKRSKSADIWREDS
LEFSLSDLSQEHLTSNEEILGSAEEKECEEARGMETQASPRQLSTCQRANSLGDLYAQKN
SGVTANGGPRSKFAGYCRNLVSDIPDLANHKMPPAAADETPPYSNYNTLPCRKSHCLSEG
ATNPQISHSNSMQGRRAKTTQDVNTGEGSEFADSGIEGATTDTDLLSRRSNATNSSYSPP
TGRAFVGSDSGSSSTGDAARQGVYENFRRELEMSTANSESLEEAGSAHSDEQSSGTLSSP
GQSDILLTAAQGTVRKAGALAVKNFLVHKKNKKVESATRRKWKHYWVSLKGCTLFFYESD
GRSGIDHNSIPKHAVWVENSIVQAVPEHPKKDFVFCLSNSLGDAFLFQTTSQTELENWIT
AIHSACAAAVARHHHKEDTLRLLKSEIKKLEQKIDMDEKMKKMGEMQLSSVTDSKKKKTI
LDQIFVWEQNLEQFQMDLFRFRCYLASLQGGELPNPKRLLAFASRPTKVAMGRLGIFSVS
SFHALVAARTGETGVRRRTQAMSRSASKRRSRFSSLWGLDTTSKKKQGRPSINQVFGEGT
DAVKKSLEGIFDDTVPDGKREKEVVLPSVHQHNPDCDIWVHEYFSPSWFCLPNNQPALTV
VRPGDTARDTLELICKTHQLDHSAHYLRLKFLIENKVQLYVPQPEEDIYELLYKEIEICP
KVTQNIQIEKSDTTADNYGFSLSSVEEDGVRRLYVNSVKETGLASKKGLKAGDEILEINN
RAAGTLNSSMLKGFLSQPSLGLLVRTYPELEGGAELLESPPHRVDGLADLSESPLAFLTS
NPGHRFCSEQGSSGETAPEETEGPDAESSDEIDHSGKSTEQVAAFCRSLHEMNPSDSSPS
PQDCSGPQMATMRQLSDADKLRKVICELLETERTYVKDLNCLMERYLKPLQKETFLTQDE
LDVLFGNLTEMVEFQVEFLKTLEDGVRLVPDLEKLEKVDQFKKVLFSLGGSFLYYADRFK
LYSAFCASHTKVPKVLVKAKTDTAFKAFLDAQNPRQQHSSTLESYLIKPIQRILKYPLLL
KELFALTDAESEEHYHLDVAIKTMNKVASHINEMQKIHEEFGAVFDQLIAEQTGEKKEVA
DLSMGDLLLHTTVIWLNPPASLGKWKKEPELAAFVFKTAVVLVYKDGSKQKKKLVGSHRL
SIYEEWDPFRFRHMIPTEALQVRALASADAEANAVCEIVHVKSESEGRPERVFHLCCSSP
ESRKDFLKAVHSILRDKHRRQLLKTESLPSSQQYVPFGGKRLCALKGARPAMSRAVSAPS
KSLGRRRRRLARNRFTIDSDAVSASSPEKESQQPPGGSGDTDRWVEEQFDLAQYEEQDDI
KETDILSDDDEFCESVKGASVDGDLQERLQAASISQRERGRRTLDSHASRMAQLKKQAAL
SGGSGGLESASDEVIWVRREDFAPSRKLNTEI
NT seq 4779 nt   +upstreamnt  +downstreamnt
atgggaaacgcagaaagtcaaactgtagcgcatgagttttatggagaaaagcatgccagc
ctgggacgcaagcacacgtcccgctcgctgcgcctctcgcacaagacacggcggacgagg
cacgcatcctcggggaaggtgatccacaggaactcggaagtgagcacacgatccagcagc
acccccagcatcccgcagtccctggctgaaaatggcctggagcccttctcccaggagggc
accctggaggacttcgggagtcccatctgggtggaccgagtggatatgggcttgagacct
gtgtcgtacactgattcttctgtcactcccagcgtagacagcagcatcgtcctcaccgca
gcctctgtgcagagcatgccagactcggaagagagcaggctttacggggatgacgctaca
tacttggctgagggaggcaggaggcagcatctctttacctccaatggacctgctttcatg
gagacagcgagctttaagaagaaacgctccaaatctgcagacatctggcgggaggatagc
ctggaattctcactctctgatctgagccaagaacatttaacaagcaacgaagaaatcttg
ggttctgccgaagagaaggagtgcgaggaggctcgggggatggaaacacaggcgagtcct
cggcagctcagcacctgtcagcgtgccaattctctgggtgacttgtatgctcagaaaaac
tccggggtgacagcaaacgggggacccaggagcaaatttgcaggctattgtcggaatttg
gtgtctgatattcccgatcttgcaaaccataagatgccaccagctgctgccgatgagact
cctccatacagtaattataacacacttccctgtaggaaatctcactgtctttccgaaggt
gccaccaacccacagattagccatagcaacagcatgcaaggcagaagagcaaaaacaact
caggatgttaacacaggtgagggcagtgagtttgcagacagtgggattgaaggggccacc
accgacacggacctcctgtccaggcgctccaatgccaccaactccagctactcgcctccc
actggccgggcctttgtgggcagtgacagcggcagcagctccaccggggatgcagctcgc
cagggggtatacgagaactttcggcgggagctggagatgagcacggccaacagtgagagc
ctggaggaggcgggctcagcacacagcgacgagcagagcagtggtaccctgagctctccg
ggccaatcggacatcctgctgactgccgcgcagggcacggtgcgcaaggctggggcactg
gccgtcaagaacttcctggtgcacaagaagaataagaaggtggagtcggccacccgccgg
aagtggaagcactactgggtgtcacttaaagggtgcacgctctttttctacgagagtgac
ggcagatctggaatagaccacaacagcatccccaagcatgccgtgtgggtggagaacagc
attgtgcaggctgtgcctgagcaccccaagaaggactttgtcttctgcctcagcaactcc
ttgggtgatgccttcctgttccagaccaccagccaaacagagcttgaaaactggatcacc
gccatccactcggcctgcgcagctgccgtggcccgacaccaccacaaagaagacacgctc
cggctgctcaagtcagaaatcaaaaaactggaacagaagatcgacatggatgagaagatg
aagaaaatgggcgaaatgcagctgtcttctgtcactgactcgaagaagaagaaaactata
ttagatcagatttttgtttgggagcaaaatctcgaacagttccaaatggacctatttcgt
ttccgctgttatttagcgagcctgcagggtggggagctaccaaaccccaaaaggctgctc
gcatttgcaagccgaccgacgaaagtggccatgggccgccttggaatattttccgtatct
tcttttcatgccctggtggcagcacgcactggtgaaactggagtgagacgacgtactcag
gccatgtccagatctgcaagcaagcgaaggagcaggttttcttctctttggggtctggac
actacctccaaaaagaagcagggacgcccaagcatcaatcaggtgtttggagagggaact
gacgctgtaaagaaatctttagagggaatatttgatgacactgttccagatggcaagagg
gagaaagaagtggtcttacctagtgtccaccagcacaatcctgactgcgacatttgggtc
cacgagtatttctctccatcctggttctgtctgcccaataaccagccagctctgacagtg
gtccggccaggagacaccgcacgggacactctggaactgatttgcaagacacatcagctg
gatcattctgctcattacctgcgtctgaaattcctaatagaaaacaaggtgcagctctac
gttccgcagcccgaggaggacatctatgagctgctgtacaaggaaattgaaatttgtcca
aaagtcactcagaacatccagattgagaagtcagatacgacggctgacaattacgggttt
tcactttcttctgtggaggaagatggtgttcgaaggctgtatgtgaacagtgtgaaggaa
actggtttagcttccaagaaaggcctgaaagccggagatgagattctcgagatcaataat
cgtgctgctgggaccttgaactcatctatgctcaaaggtttcctctcacagccctccctg
ggcctcctggtgaggacctacccggagctggagggaggagcagagctgctggagagcccc
ccgcaccgggtggacggccttgcagacctcagtgagagccccctcgccttcctcaccagc
aacccaggacacaggttctgcagcgagcaaggcagcagtggagagactgctccggaggag
acggaagggccggacgcggaatcctccgatgagattgatcacagtggcaagagtacagaa
caggtggccgccttctgccgcagtttgcacgagatgaacccctctgactccagcccgtct
cctcaggactgctcagggccgcagatggcaaccatgagacagctgtcggacgcggataag
ctgcgcaaggtgatctgcgagctcctggagacggagcgcacctacgtgaaggacttaaac
tgtctcatggagagatacctgaaacctcttcaaaaggaaactttcctcacccaagatgag
ctggatgtactctttggaaatttaactgaaatggtagagtttcaagtagaattccttaaa
acgctagaagatggcgtgagactggtccctgatttggaaaagcttgagaaagtcgaccag
tttaagaaagtgctgttctccctggggggatcctttctgtattatgctgaccgcttcaag
ctctacagtgccttctgcgccagccacacaaaagtccccaaagtcttggtgaaagccaag
actgacacggctttcaaggcattcctggatgcccagaaccccaggcagcagcactcatcc
acactggagtcttacctcatcaaacccatccagaggatcctcaagtacccacttctgctc
aaggagctgttcgcgctgaccgacgctgagagtgaggagcactaccacctggacgtggcc
atcaagaccatgaacaaggttgccagccacatcaatgaaatgcagaaaatccacgaagag
tttggggctgtgtttgaccagctgatcgctgaacagactggggagaagaaagaggttgca
gatctgagcatgggggacctgcttttacacaccactgtgatctggctgaacccaccggcc
tccctggggaagtggaaaaaggagccagaattggcagcctttgtcttcaaaacagctgtg
gtccttgtgtataaagatggttccaaacagaagaagaagctggtaggatctcacaggctt
tccatttatgaggagtgggaccccttccgatttcgacacatgattcccaccgaagctctg
caggttcgagctttggcaagtgcagatgcagaagcaaatgccgtgtgtgaaattgtccat
gtgaaatcggagtctgaagggagaccagagagggtcttccacctgtgctgcagctcccca
gagagccggaaggatttcctgaaggctgtgcattcgattctgcgtgataagcacagacga
cagctgctcaaaaccgaaagcctcccctcctcccagcaatatgtcccctttggaggaaag
agattgtgtgcgctgaagggggccaggccagccatgagcagggcagtgtctgccccaagc
aagtctcttgggaggaggcggcggcgactggctcgaaacaggtttaccattgattccgat
gctgtctcggcaagcagcccggagaaagagtcccagcagccccccggcggcagcggggac
actgaccgatgggtagaggagcagtttgaccttgctcagtatgaggagcaggatgacatc
aaggagacagacatcctgagtgacgatgatgagttctgtgagtcggtgaagggcgcctca
gtggacggagacctgcaggagcggcttcaggctgcctccatcagtcagcgggagagaggc
cggagaacactggacagccacgcgtcccgcatggcgcagctcaagaagcaagctgcgctc
tcgggtggcagtggcgggctggagagcgccagcgacgaggtcatttgggttaggcgtgaa
gattttgccccctccaggaaactgaacactgagatctga

DBGET integrated database retrieval system