KEGG   Oryctolagus cuniculus (rabbit): 100338403
Entry
100338403         CDS       T03373                                 

Gene name
SERPINB5
Definition
(RefSeq) serpin family B member 5
  KO
K10139  serpin B5
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04115  p53 signaling pathway
ocu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100338403 (SERPINB5)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100338403 (SERPINB5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ocu01002]
    100338403 (SERPINB5)
Peptidases and inhibitors [BR:ocu01002]
 Peptidase inhibitors
  Family I4: serpin family
   100338403 (SERPINB5)
SSDB
Motif
Pfam: Serpin
Other DBs
NCBI-GeneID: 100338403
NCBI-ProteinID: XP_002713678
Ensembl: ENSOCUG00000016787
UniProt: G1TCD0
LinkDB
Position
9
AA seq 375 aa
MDALRLANSAFAVDLFKQLCEKEPEGNVLFSPICLSTSLSLAQVGAKGDTANEIGQVLHF
ENVKDVPFGFQTVTSDVNKLSSFYSLKLIKKLYVDKSLNPSTEFISSTKRPYAKELETVD
FKDKSEETKGQINDSIKELTDGHFENILGDNNINDQTKILVVNAAYFVGKWMKKFPESET
KECPFRVNKTDSKPVQMMNMEATFCMGNIDDINCKVIELPFQNKHLSMLILLPKDVEDES
TGLEKIEKQLNSETLLQWTNPSTMANAKVKLSIPKFKVEKMIDPKASLENLGLKTIFDEN
TSDFSGMSETKGVALSHVIHRVCLEINEDGGESIEVPGSRILQHKDEFNADHPFIYIIRH
NKTRNIIFFGKFCSP
NT seq 1128 nt   +upstreamnt  +downstreamnt
atggatgctctacgactggcaaattcagcttttgccgttgacctgttcaaacaactgtgt
gaaaaggagccagagggcaatgtcctcttttctccaatctgtctctctacctctctgtca
cttgctcaagtaggtgccaaaggtgacacagcaaatgagattggacaggtccttcacttt
gaaaatgtcaaagatgtaccctttggatttcaaacagtcacatctgatgtcaacaaactt
agttctttttactcattgaaactgatcaagaagctctatgtggacaaatctctgaaccct
tctacggagttcattagctctacaaagagaccttatgcaaaagaattggaaaccgttgac
ttcaaagataaatcagaagaaaccaaaggccagatcaatgactcaattaaggagctcaca
gacggccactttgagaacattctaggtgacaacaatataaatgaccagaccaaaatcctt
gtggtgaatgctgcctactttgtcgggaagtggatgaagaaatttcctgaatcagaaaca
aaagaatgccccttcagagtcaacaagacagactccaaaccagtgcagatgatgaatatg
gaagctaccttctgtatgggcaacattgatgacatcaattgtaaggtcattgagcttcct
tttcaaaataaacatctcagcatgctcatcctgctgcccaaggatgtggaggacgagtcg
acaggcttggagaagattgagaaacagctcaactcagagacgctgttgcagtggacaaat
cctagcaccatggctaatgccaaagtcaaactctccattccaaaatttaaggtggaaaag
atgattgatcccaaagctagcctggaaaatctagggctgaaaactatctttgatgaaaat
acctctgatttttctggaatgtcagagaccaagggagtggccctatcacacgttattcac
agagtgtgcttggaaataaatgaagatgggggagagtccatagaggtgcctggatcacgg
atcctgcaacacaaggatgagttcaatgctgaccacccatttatttacatcatcaggcac
aacaaaactcgaaacatcattttctttggcaagttctgttctccttaa

DBGET integrated database retrieval system