KEGG   Oryctolagus cuniculus (rabbit): 100338458Help
Entry
100338458         CDS       T03373                                 

Gene name
HDAC4
Definition
(RefSeq) histone deacetylase 4
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04371  Apelin signaling pathway
ocu05034  Alcoholism
ocu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100338458 (HDAC4)
 09160 Human Diseases
  09161 Cancers: Overview
   05203 Viral carcinogenesis
    100338458 (HDAC4)
  09165 Substance dependence
   05034 Alcoholism
    100338458 (HDAC4)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100338458 (HDAC4)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     100338458 (HDAC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 100338458
NCBI-ProteinID: XP_017195246
LinkDB All DBs
Position
Un
AA seq 1103 aa AA seqDB search
MPSEERLLTGLWARAEVLPEDGLSGRDQPVELLSPPRVNHMPSTVDVATALPLQVAPSAV
PMDLRLDHPFALPVAEPALREQRLQQELLALKQQQQLQRQVLIAEFQRQHEQLSRQHEAQ
LQEHIKQQQEMLAMKHQQELLEHQRKLERHRQEQELEKQHREQKLQQLKNKEKGKESAVA
STEVKMKLQEFVLNKKKALAHRNLNHCISSDPRYWYGKTQHSSLDQSSPPQSGTSASYAH
PVLGMYDTKDDFPLRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTALKKRPLDV
TDSACSSAPGSGPSSPNNNSSGNVSTENGGVPAAPSIPTEASLAPRLVTREGSVAPLPLY
TSPSLPNITLGLPATGPSAGAAAQQDTERLALPALQQRISLFPGSHLAPYLSTSPLERDG
GAAHSPLLQHMVLLEQPPVTDWYLSGLGALPLHTQPLVGADRVSPSIHKLRQHRPLGRTQ
SAPLPQNAQALQHLVIQQQHQQFLEKHKQQFQQQLHLNKIISKPSEPPRQPESHPEETEE
ELREHQALLDQPYLERLSGQKEAQVAGVQVKQEPIESDEEEAEPREAEPGQRPPTEQELL
FRQVSVGTGRPPAAPTWSSGKGPLCFPVVLFRVGRAQALGICLLCVCVSRFPHIQALPAG
TLPGCRRGRWAWAGLVYDTLMLKHQCACGNTNSHPEHAGRIQSIWSRLQETGLRSQCECI
RGRKATLEELQTVHSESHTLLYGTNPLNRQKLDSKKLLGSLTSVFVRLPCGGVGVDSDTI
WNEVHSAGAARLAVGCVVELVFKVATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAVA
ARLLQQRLNVSKILIVDWDVHHGNGTQQAFYSDPSVLYVSLHRYDDGNFFPGSGAPDEVG
TGPGVGFNVNMAFTGGLDPPMGDTEYLAAFRTVVMPIANEFAPDVVLVSSGFDAVEGHPT
PLGGYNLSAKCFGYLTKQLMGLAGGRIVLALEGGHDLTAICDASEACVSALLGNELDPLP
EQVVQQRPNANAVRSMEKVMDIHSKYWRCLQRLSSTAGHSLMEAQKCENEEAETVTAMAS
LSVGVKPAEKRPEEEPMEEEPPL
NT seq 3312 nt NT seq  +upstreamnt  +downstreamnt
atgccctcggaggagcgactgctgacgggtctctgggcacgagcagaagtcctgcctgaa
gatggactctctggccgagaccagccggtggagctgctgagccctccacgcgtgaaccac
atgcccagcacggtggacgtggccacagcactgcctctgcaagtggcaccctcggccgtg
cccatggacctgcgcctggaccacccgttcgcgctgccggtggccgagcccgcgctgcgg
gagcagcggctgcagcaggagctcctggcgctgaagcagcagcagcagctgcagaggcag
gtcctcatcgccgagttccagcggcagcacgagcagctgtcgcggcagcacgaggcccag
ctgcaggagcacatcaagcagcagcaggagatgctggccatgaagcaccagcaggagctg
ctggagcaccagcgcaagctggagcggcaccggcaggagcaggagctggagaagcagcac
cgcgagcagaagctgcagcagctcaagaacaaggagaaaggcaaagagagtgccgtggcc
agcacagaggtgaagatgaagttgcaagaattcgtgctcaataagaagaaggcgctggcc
cacaggaacctgaaccactgcatttccagtgacccccgctactggtacgggaaaacgcag
cacagctccctggaccagagttcaccgccccagagcgggacgtccgcctcctacgcccac
ccggtgctggggatgtacgacaccaaagacgacttcccgctcaggaagacagcttctgaa
cccaacttgaaactgcggtcccggctcaagcagaaagtggccgagaggcggagcagcccc
ctgctgcgcaggaaggatgggccagtggtcaccgctctcaaaaagcgtccgttggatgtc
acagactctgcgtgcagcagcgccccgggctccgggcccagctcgcccaacaacaacagc
tctgggaacgtcagcacggagaacggcggcgtgccggccgcacccagcatccccactgag
gccagcttggcgcccaggcttgtgacgagagaaggctctgtggccccgctccctctctac
acgtcgccatccctgcccaacatcaccttaggacttccggccaccggcccgtctgctggc
gcagcggcccagcaggacaccgagaggctggcgctccccgccctgcagcagcggatctcc
ctgttccctggcagccacctcgccccctacctgagcacctcgcccctggagcgggacggc
ggggcagcccacagcccccttctgcagcacatggtgttgctggagcagccgcccgtgaca
gactggtatctttcaggcctgggagcactgcccctccacacacagcccctggttggtgca
gaccgggtgtccccatccatccacaagctgcggcagcaccgcccgctggggcgcacgcag
tcggcgccgctgccgcagaacgcgcaggcgctgcagcacctggtcatccagcagcagcac
cagcagttcctggagaagcacaagcagcagttccagcagcagctgcacctgaacaagatc
atctccaaacccagcgagccgccccggcagcctgagagccaccccgaggagacggaggag
gagctccgcgagcaccaggccctgctggaccagccgtacctggagcggctctctgggcag
aaggaggcgcaggtggcgggggtgcaggtgaagcaggagcccatcgagagtgacgaggag
gaggcggagccccgagaggcggagcccggccagcgcccgcccacagagcaggagctgctc
ttcagacaggtgagtgtgggcactgggcggccgccggcagcccccacgtggtcatcaggg
aagggccccctgtgtttccctgtggttctgttccgcgtcggccgggcccaggcactgggc
atttgcctgctgtgcgtgtgtgtctcccgcttcccacacatccaggcactcccagccgga
actctgcccggctgccggaggggaagatgggcctgggcaggcctcgtgtacgacacgctg
atgctgaagcaccagtgcgcctgcggcaacaccaacagccaccccgagcacgccgggcgc
atccagagcatctggtcccgcctgcaggagaccgggctgcgcagccagtgcgagtgcatc
cgcggacggaaggccacactggaggagctgcagacggtgcactcggagagccacacactc
ctctacggcacaaaccccctcaacaggcagaaactggacagtaagaaacttctaggctcc
ctgacctccgtatttgtcaggctcccctgtggtggtgttggggtggacagcgacaccatc
tggaacgaggtgcactcggcgggggcggcccgcttggccgtgggctgcgtggtggagctg
gttttcaaggtggccacgggggaactgaagaacggctttgcggtggtccggcccccagga
caccacgccgaggagagcacacccatggggttctgctacttcaactccgtggccgtggcc
gccaggctgctgcagcagaggctgaacgtgagcaagatcctcatcgtggactgggatgtg
caccacgggaacgggacccagcaggctttctacagcgaccccagcgtgctctacgtgtcc
ctgcaccgctacgacgatggcaacttcttcccgggcagcggggcacccgacgaggtgggc
acagggcccggcgtgggcttcaacgtcaacatggctttcaccggcggactggacccaccc
atgggggacaccgagtacctggcggccttcaggacggtggtcatgccgatcgccaacgag
tttgccccagacgtggtgctggtgtcgtcgggcttcgacgccgtggagggccaccccacg
ccgctcgggggctacaacctctctgccaaatgtttcgggtacctgaccaagcagctgatg
ggcctggctggcggccgcatcgtcctggccctcgagggaggccacgacctgacggccatc
tgtgacgcctctgaggcttgcgtgtctgcactgctgggaaatgagctcgaccctctgccc
gagcaggtggtccagcagagacccaacgcgaacgccgtccgctccatggagaaggtcatg
gacatccacagcaagtactggcgctgcctgcagcgcctgtcctccacggccgggcactcc
ctgatggaggcgcagaagtgcgagaacgaggaggcggagacggtcacggccatggcctcg
ctgtccgtgggcgtgaagccggccgagaagagacccgaggaggagcccatggaggaggag
ccgcccctgtag

DBGET integrated database retrieval system