KEGG   Oryctolagus cuniculus (rabbit): 100338523Help
Entry
100338523         CDS       T03373                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase 2 family (mitochondrial)
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00010  Glycolysis / Gluconeogenesis
ocu00053  Ascorbate and aldarate metabolism
ocu00071  Fatty acid degradation
ocu00280  Valine, leucine and isoleucine degradation
ocu00310  Lysine degradation
ocu00330  Arginine and proline metabolism
ocu00340  Histidine metabolism
ocu00380  Tryptophan metabolism
ocu00410  beta-Alanine metabolism
ocu00561  Glycerolipid metabolism
ocu00620  Pyruvate metabolism
ocu01100  Metabolic pathways
Module
ocu_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100338523 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    100338523 (ALDH2)
   00620 Pyruvate metabolism
    100338523 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    100338523 (ALDH2)
   00561 Glycerolipid metabolism
    100338523 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100338523 (ALDH2)
   00310 Lysine degradation
    100338523 (ALDH2)
   00330 Arginine and proline metabolism
    100338523 (ALDH2)
   00340 Histidine metabolism
    100338523 (ALDH2)
   00380 Tryptophan metabolism
    100338523 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100338523 (ALDH2)
Enzymes [BR:ocu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     100338523 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 100338523
NCBI-ProteinID: XP_008270467
Ensembl: ENSOCUG00000008325
LinkDB All DBs
Position
21
AA seq 521 aa AA seqDB search
MLRAAALAATGLRPFVGRRLLSAAATQAVPAPNQQPEVFYNQIFINNEWHDAASRKTFPT
VNPSTGEVICQVAEGDKEDVDRAVKAARAAFQLGSPWRRMDASERGRLLYRLADLIERDR
TYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSFTRHEPV
GVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVN
IVPGFGPTAGAAIASHHDVDKVAFTGSTEVGHLIQVAAGSSNLKRVTLELGGKSPNIIMS
DTDMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDVYAEFVERSVARAKARVVGNPFDSQT
EQGPQVDETQFKKILGYINSGKQEGAKLLCGGGAAAERGYFIQPTVFGDVQDGMTIAKEE
IFGPVMQILKFKTIEEVVGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVF
GAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgcgccgctgcactcgccgccaccggcctccggcccttcgtgggccgccgcctc
ctgtctgccgccgccacccaggccgtgccggcccccaaccagcagccggaggtcttctac
aatcagatcttcataaacaatgagtggcacgatgcggccagcaggaagaccttccccacg
gtcaacccgtccaccggcgaggtcatctgtcaggtggctgaaggggacaaggaagatgtg
gacagggcggtgaaggccgccagggccgccttccagctgggctccccgtggcgccgcatg
gacgcgtccgagaggggccggctgctctaccgcctggcggatctgatcgagcgcgaccgg
acctacctggcggccctggagaccctggacaatggcaagccctacgtgatctcctacctg
gtggacttggacatggtcctcaagtgcctgcggtattatgccggctgggctgataagtac
cacgggaaaaccattcccatcgacggggacttcttcagcttcacgcgccacgagcccgtg
ggggtgtgcgggcagatcatcccgtggaacttccccctcctgatgcaagcgtggaagctg
ggccccgccctggcgactggaaacgtggtggtcatgaaggtggccgagcagacgccgctc
actgccctctatgtggccaacttgatcaaggaggctggctttccccccggagtggtcaac
atcgtcccaggattcggtcccaccgccggggccgccatcgcctcccaccacgacgtggac
aaagtggcgttcactggttccaccgaggttggccacctgatccaggttgccgcagggagc
agtaacctcaagagagtgaccctggagctgggggggaagagccccaacatcatcatgtcc
gacaccgacatggactgggccgtggagcaggcccacttcgccctgttcttcaaccagggc
cagtgctgctgcgccggctcccggaccttcgtgcaagaggacgtttacgcggagttcgtg
gaacgcagcgtggcccgggccaaggcccgcgtggtcgggaacccctttgacagccagacc
gagcaggggccgcaggtggacgagacgcagttcaagaagattctgggctacatcaactct
ggcaagcaggagggggcgaagctgctgtgcggcggcggggcggccgctgagcggggctac
ttcatccagcccaccgtgttcggggacgtgcaggacggcatgaccatcgccaaggaagag
atctttgggccagtgatgcagatcctgaagttcaagaccatcgaggaggttgttgggaga
gccaacaattccaagtatgggctggctgcagctgtcttcacaaaggacctggacaaggcc
aattatctgtcccaagccctccaggcaggcactgtgtgggtcaactgctatgatgtgttt
ggggcccagtccccatttggtggctacaagatgtcgggcagcggccgggagctgggcgag
tacggtctgcaggcctacaccgaagtgaagacggtcacggtcaaggttccccagaagaac
tcgtga

DBGET integrated database retrieval system