KEGG   Oryctolagus cuniculus (rabbit): 100338600
Entry
100338600         CDS       T03373                                 

Gene name
ASH2L
Definition
(RefSeq) ASH2 like histone lysine methyltransferase complex subunit
  KO
K14964  Set1/Ash2 histone methyltransferase complex subunit ASH2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100338600 (ASH2L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ocu03036]
    100338600 (ASH2L)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Histone modification proteins
   HMT complexes
    COMPASS/SET1 complex
     100338600 (ASH2L)
    MLL-HCF complex
     100338600 (ASH2L)
    MLL3/MLL4 complex
     100338600 (ASH2L)
SSDB
Motif
Pfam: SPRY PHD20L1_u1
Other DBs
NCBI-GeneID: 100338600
NCBI-ProteinID: XP_008272214
LinkDB
Position
Un
AA seq 560 aa
MESANGKDTLAQDGAGDTSEVMDVQAGSVDENCRQLGEVELQCGICTKWFTAETFGIDTS
SCLPFMTNYSFHCNVCHHSGNTYFLRKQANLKEMCLSALANLTWQSRTQDEHPKTMFSKD
KDIIPFIDKYWECMTTRQRPGKMTWPNNIVKTMSKERDVFLVKEHPDPGSKDPEEDYPKF
GLLDQDLSNIGPAYDNQKQSSAVSTSGNLNGGAILGGGIAAGSSGKGRGAKRKQQDGGTT
GTTKKARSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLELDCWAGKPI
PGDLYRACLYERVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGAWYFEITVD
EMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSGYGQGDVLGF
YINLPEDTETAKSLPDTYKDKALIKFKSYLYFEEKDFVDKAEKSLKQTPHSEIIFYKNGA
NQGVAYKDIFEGVYFPAISLYKSCTVSINFGPCFKYPPKDLACRPMSDMGWGAVVEHTLA
DVLYHVETEVDGRRSPPWEP
NT seq 1683 nt   +upstreamnt  +downstreamnt
atggagtccgcgaatgggaaggatacactagcacaggacggcgccggggacacgtcggag
gtgatggacgtgcaggcgggctcggtggacgagaactgccggcagctgggggaagtggag
ctgcagtgtggcatctgtacgaaatggttcacggcggagaccttcggcatcgacacttca
tcctgcctgcctttcatgactaactacagttttcattgcaatgtttgccatcacagtggg
aatacctatttcctccggaagcaagcaaacttgaaggaaatgtgccttagtgctttggcc
aaccttacatggcagtcccgaacacaggatgagcacccgaaaaccatgttctccaaagat
aaggatattataccatttattgataaatactgggagtgcatgacaaccagacagagacct
gggaaaatgacttggccaaataacattgttaaaaccatgagtaaagagagagatgtgttt
ttggtaaaggagcatcctgatccagggagcaaagaccctgaagaagactaccccaaattt
ggacttctggatcaggatcttagtaacatcggtcctgcttacgacaaccagaaacaaagc
agtgctgtgtctaccagtgggaatctaaatggcggagccattttgggagggggcattgca
gcagggagcagtggaaaaggaagaggagccaagcgcaaacagcaggacggagggaccacg
gggaccaccaagaaggcccgcagtgaccctttgttttctgctcagcgccttcccccccat
ggctaccccttggagcatccatttaataaagatggctatcggtatattttagctgagcct
gacccccacgcccctgaccctgagaagctcgaacttgactgctgggcaggaaaacctatc
cctggagacctctacagagcctgcttgtacgagcgagttttgttagccctacatgatcga
gctccccagctgaagatctccgatgaccggctgactgtggttggagagaagggctactcc
atggtgcgggcctctcacggggtgcggaaaggtgcctggtactttgagatcactgtggat
gagatgccacctgacactgctgccagacttggttggtctcagcccttaggcaacctccaa
gctcccttgggctatgacaaattcagctattcttggcggagcaaaaagggaaccaagttc
catcagtccattggcaaacactattcctctggctacggacagggagatgtcctgggattc
tacatcaaccttcctgaagacacagagacagccaagtcattgcctgacacatacaaagac
aaggctttgatcaagttcaagagttatctgtattttgaggagaaagacttcgtggataaa
gcagagaagagcctaaagcagactccccatagtgagataatattttataaaaatggtgcc
aatcaaggtgtggcttacaaagatatttttgagggggtttacttcccagccatctcactg
tacaagagctgcacggtctccattaacttcgggccgtgcttcaagtatcctcccaaagac
ctcgcttgccgccccatgagtgacatgggctggggcgctgtggtagagcacaccctggcc
gacgtcttgtatcacgtggagacagaagtggacggcaggcggagtcccccgtgggaaccc
tga

DBGET integrated database retrieval system