KEGG   Oryctolagus cuniculus (rabbit): 100338777
Entry
100338777         CDS       T03373                                 

Gene name
NXF3
Definition
(RefSeq) nuclear RNA export factor 3
  KO
K14284  nuclear RNA export factor
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03008  Ribosome biogenesis in eukaryotes
ocu03013  RNA transport
ocu03015  mRNA surveillance pathway
ocu05014  Amyotrophic lateral sclerosis
ocu05164  Influenza A
ocu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    100338777 (NXF3)
   03015 mRNA surveillance pathway
    100338777 (NXF3)
   03008 Ribosome biogenesis in eukaryotes
    100338777 (NXF3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100338777 (NXF3)
  09172 Infectious disease: viral
   05164 Influenza A
    100338777 (NXF3)
   05168 Herpes simplex virus 1 infection
    100338777 (NXF3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100338777 (NXF3)
   03009 Ribosome biogenesis [BR:ocu03009]
    100338777 (NXF3)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     100338777 (NXF3)
   mRNA cycle factors
    Stress granule specific factors
     100338777 (NXF3)
Ribosome biogenesis [BR:ocu03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    100338777 (NXF3)
SSDB
Motif
Pfam: Tap-RNA_bind TAP_C NTF2
Other DBs
NCBI-GeneID: 100338777
NCBI-ProteinID: XP_008271340
Ensembl: ENSOCUG00000008684
LinkDB
Position
X
AA seq 610 aa
MGHNRQINSQRRRPGCLHFYHRRLLNCPEMVRSGMYLSSQQQQEGNPATSDAQVDSQIRY
APYAISSYRRRGSFRKQYQTRGKMEKEQNLPERRMEGTQGGISSNWFKITIPFGIKYNEQ
WLLDLIQRQCSIPFRPVEFHYDKMQAHFFVENSCIASALKNISGKIWDENHEGISIFVTP
SEVPRSVQEELKLEKVEQIKLTTNIQGDASQQPADIKNLSSDPDLMAHNIEMASNPRMCE
ASSLQIHEENMPKVLTLDPSHNPTYLLVGRPGTAQKATNINNVNISKTEVKSLGKTDKEK
GLDPEKMRMDRNPQGATCPDKSSNINSILELFPKLLSLDGPKSPGTLCGTEANKMLPTSK
GSFFGSEILKNVILQFLQQYYLFYDYGDRCSLLGAYHDEACFSLTVPFNSMDLIPSSLCE
YLKNSRNIKNVTDRHLRRQLLQHTNHAIVDVLRVLPKTQHDFSSFLVDMWFQTETMLCFS
VNGVFKEVEGDSQGCVWAFTRTFITIPTSNSSLCIMNDKLFMQNTRTREPQSAFSISVPT
PCSSSMPTLSQAQQEMVQALSIQYGVNLEWSQKCLHDNNWDYARAAQFLTLPKVKGKMPG
EPLKQADPRS
NT seq 1833 nt   +upstreamnt  +downstreamnt
atgggacacaatcgccaaattaattcccaacgaagaagaccaggatgcttgcatttttac
cacagaagattgcttaattgccctgagatggttcgttctggcatgtatctttcatcccag
cagcagcaagaaggaaatccagcaacaagtgatgcccaggtggattcacaaataagatac
gctccctatgccatttcatcctatcgtcggagaggtagttttcgtaaacaataccaaact
cgtggtaagatggagaaagaacaaaatcttccagagagaagaatggaggggacacagggt
gggatttcgagcaactggttcaagatcacaattccatttggcataaaatataatgagcag
tggctattggacttgattcagagacagtgcagtatcccattcaggccggttgagtttcac
tatgataaaatgcaagcccacttctttgttgagaattcctgtattgcctctgctttgaag
aatatcagtggcaagatttgggacgagaatcacgaagggatatcaatcttcgtcactccc
tctgaggtaccccgctctgtgcaggaggagttgaaattggaaaaagtggaacagattaag
ctgactacaaacatacaaggtgatgcctcccagcaacctgctgacatcaagaacctcagc
tctgacccagacttgatggcccataatattgaaatggcatcaaatcctagaatgtgcgag
gcttcctccctgcaaatccatgaagagaacatgcccaaggttttgactttggacccaagt
cacaatccaacctatctgctggttggccggcctggcactgcacaaaaggctacaaacatc
aataatgtgaatatctccaaaactgaggtgaagtctttggggaagacggacaaggagaaa
gggctggatccagaaaaaatgcgtatggacagaaacccccagggtgccacctgcccggat
aagtccagcaacataaactctatcctagaattgttccccaagttattaagcctggatggc
ccaaagtcacctggaaccctctgtggcacggaagcgaacaagatgttaccaactagcaag
ggaagcttcttcggatctgagatactgaagaacgtgatcctgcagtttctgcagcagtat
tacttgttctatgactatggagatcgctgtagtcttcttggtgcttaccatgatgaggcc
tgcttctccctgaccgttcccttcaactccatggatctgatcccgagcagtctgtgtgag
tatttgaagaacagcaggaatatcaagaatgtcacggaccgccacctgcgaaggcaactg
ctgcaacacacaaaccatgccattgtggatgtcctccgtgtgttacccaaaactcagcat
gacttcagctccttcttggtggacatgtggttccagacggaaactatgctctgcttttct
gtcaacggggtgttcaaggaagtggaaggagattctcagggatgtgtttgggctttcact
cggaccttcatcactatccctaccagcaattccagcctgtgcatcatgaatgacaagctg
tttatgcagaacaccagaacccgagagcctcagagtgccttctccatctcagtgcccaca
ccctgctccagctccatgcctactctctctcaggcacagcaagaaatggtgcaggctttg
tccattcagtatggagtgaacctcgagtggtctcagaaatgtcttcatgacaacaactgg
gattatgccagagctgctcagtttctcactctgcccaaggtcaagggcaagatgccaggg
gagcctctcaaacaggctgatccaagatcatga

KEGG   Oryctolagus cuniculus (rabbit): 100339773
Entry
100339773         CDS       T03373                                 

Definition
(RefSeq) nuclear RNA export factor 2
  KO
K14284  nuclear RNA export factor
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03008  Ribosome biogenesis in eukaryotes
ocu03013  RNA transport
ocu03015  mRNA surveillance pathway
ocu05014  Amyotrophic lateral sclerosis
ocu05164  Influenza A
ocu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    100339773
   03015 mRNA surveillance pathway
    100339773
   03008 Ribosome biogenesis in eukaryotes
    100339773
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100339773
  09172 Infectious disease: viral
   05164 Influenza A
    100339773
   05168 Herpes simplex virus 1 infection
    100339773
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100339773
   03009 Ribosome biogenesis [BR:ocu03009]
    100339773
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     100339773
   mRNA cycle factors
    Stress granule specific factors
     100339773
Ribosome biogenesis [BR:ocu03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    100339773
SSDB
Motif
Pfam: Tap-RNA_bind TAP_C NTF2 LRR_8
Other DBs
NCBI-GeneID: 100339773
NCBI-ProteinID: XP_008271331
Ensembl: ENSOCUG00000005789
UniProt: G1SPN8
LinkDB
Position
X
AA seq 592 aa
MESNNGGGCPQGKKKDDEDSLQGKFDHGNFHYEHAVGELLSSNLQEDRNRMMRDVHENPQ
LRRSMECHYEHQDRILPEGAVTANTDNEALRKLFKITIPYGIKYEKTWLINSIQSYCSVP
FTPINLRYVRNQVEFFVQDASTASTLEDINYKIYDEENQKISILVEPSTETHSVQTNLKP
EQMEVLMLTMNKRYDVSQKALDLQSLSFDRDLVGHETDMILDERKCMTAALQIIEKNFSE
LLSLNLCNNKLYQLDGLSDIIGKVPKVKILNLSANELRTAWELEKVKELDLEELWLEGNP
LCRTFPSHAAYVRAIRNCFPKLLRLDGKELPPIAIDMEVPEIIKPCKESYKGSETLKSLI
LQFLLRYYVIYDSGDRRGLFGAYHEKACFSLTIPFNCGDPFSLWEYFKYSRNMKKLKDPY
LRRQLLKHTKHDIVNSLSVLPRTQHDFSSCVVDLCFQTEMMLCFSVSGVFKELEGKSPGI
VRAFTRIFILASVSSSSICIVNDKLIVRNASPKETQSAFSTPLPSCFSSSVPTLSQEKME
MVKAFSTQSGMNLEWSQKCLEDNEWNYATAAQIFTMLQRQGRIPEEAFKQIP
NT seq 1779 nt   +upstreamnt  +downstreamnt
atggaatccaataatggtggtggctgtcctcaaggaaaaaagaaagatgatgaagattct
ttgcaagggaaatttgaccatgggaactttcattatgaacatgctgtgggtgagcttctg
tcttcaaacctccaggaggatcgaaacaggatgatgagggatgtccatgagaacccccag
ctaagacggagcatggaatgccattatgaacatcaagatagaattcttccagagggagct
gtgacagcaaatacagataatgaagccctgaggaaattgttcaagataacaattccctac
gggataaagtatgagaagacatggctaattaattcaatccagagctattgcagtgtccct
ttcaccccaatcaacctcaggtatgtcagaaatcaagtggagttctttgttcaggatgct
agcactgcctcgacattggaggatatcaactacaagatttatgatgaggaaaatcaaaag
atatctatccttgttgaaccttccactgaaactcattctgtgcagactaacttaaagcca
gagcaaatggaggtgctaatgttgaccatgaacaaacgatatgatgtttcccagaaagct
cttgacctccagagcctcagctttgaccgagacttggtaggccatgaaactgacatgatc
ttggatgaaagaaaatgtatgactgctgccctgcagatcattgaaaagaatttctctgag
ctgttgtccttgaatttgtgtaacaacaagctgtaccagctggatggcttgtctgacatt
atagggaaggtgcccaaagtcaagatcctgaacctctctgcaaacgagctgaggacagca
tgggaattggagaaggtgaaagagctggatctggaagagctgtggctggaagggaacccc
ttgtgcagaaccttccctagccatgctgcctacgtaagggccatccggaattgtttcccc
aagttattacgcctggatggaaaggagttaccaccaattgcaattgatatggaagtccct
gagataataaaaccttgtaaggaaagctataaaggatctgagaccctgaagagtctcatc
ctgcaatttctgcttcggtattatgtgatttatgactctggagatcgacggggtctcttt
ggtgcttaccatgaaaaggcctgcttctccctgaccatccccttcaactgtggtgatcca
ttcagcttatgggagtactttaagtatagcaggaatatgaagaagctcaaggacccatac
ctgcggaggcagctgctgaagcacacaaagcatgacattgtgaattctctcagtgtcttg
cccagaactcagcatgacttcagctcctgtgtggtggacctgtgttttcagacagaaatg
atgctctgcttttctgtcagtggtgtgttcaaggaattggaaggaaagtccccgggtatt
gttcgtgccttcaccaggatcttcatcttggcttctgtcagcagttccagcatatgcatt
gtgaatgacaagctgattgtgaggaatgccagccccaaagagacccagagtgccttttcc
actcccttgccctcatgcttctccagctctgtgcccaccctctcccaagagaagatggaa
atggtgaaggctttctccacccagtctgggatgaatttggaatggtctcagaagtgcctt
gaagacaacgagtggaactatgccacagctgcgcagatctttactatgctccagaggcag
ggcaggatcccggaggaggccttcaagcaaattccctaa

KEGG   Oryctolagus cuniculus (rabbit): 100340535
Entry
100340535         CDS       T03373                                 

Gene name
NXF2
Definition
(RefSeq) nuclear RNA export factor 2
  KO
K14284  nuclear RNA export factor
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03008  Ribosome biogenesis in eukaryotes
ocu03013  RNA transport
ocu03015  mRNA surveillance pathway
ocu05014  Amyotrophic lateral sclerosis
ocu05164  Influenza A
ocu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    100340535 (NXF2)
   03015 mRNA surveillance pathway
    100340535 (NXF2)
   03008 Ribosome biogenesis in eukaryotes
    100340535 (NXF2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100340535 (NXF2)
  09172 Infectious disease: viral
   05164 Influenza A
    100340535 (NXF2)
   05168 Herpes simplex virus 1 infection
    100340535 (NXF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100340535 (NXF2)
   03009 Ribosome biogenesis [BR:ocu03009]
    100340535 (NXF2)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     100340535 (NXF2)
   mRNA cycle factors
    Stress granule specific factors
     100340535 (NXF2)
Ribosome biogenesis [BR:ocu03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    100340535 (NXF2)
SSDB
Motif
Pfam: Tap-RNA_bind TAP_C NTF2 LRR_4 LRR_8
Other DBs
NCBI-GeneID: 100340535
NCBI-ProteinID: XP_008271326
Ensembl: ENSOCUG00000015043
LinkDB
Position
X
AA seq 617 aa
MSFTQRKSGANQREERSGSSSVHEGRKRSWGSFQGNFSGRNLLYEHSRHEHLRSHRHDDD
GTVAMRNVHQEPQLRRTPNNMQYSKRRLKYNHDHVDAYGSKKCPEGEMEDGTVSCWFKVT
VPNGRKYNKKWLLSSIQSESTVHFTPVDFHYINNQARFFVQYSDTASALKNVSHKICDDE
NRKIPIFVNRSSVPYSVKNKLKPEEMEQLKLTLNKRYDASRQALDLQNLRFDPDLVGHDI
DMILNRRQCMDATLKIIEGNFPELLSLNLCNNKLYQLDGLCDIIENAPKVKILNLSNNEL
KTACELNKLKELNLEELWLEGNPLWRTFPNHSAYVSAMQDCFPNLLRLDGREIASPVVID
VGAPKLVKLSKEIPKGTEMLKSLVLQFLQEYYFIYDYGDRRGLLGTYHDKACFSLTMPFN
SMDPVPSGLFVYLQNSRNIKNVTDPHLRRQLLKHTSRDIVDALSVLPRTKHDFSSFSIDM
WFHTETMLCFSVNGVFKEENGSPDSVFAFTRTFIAIPGSTSSLCITNDQLFVKNVSSSML
QCTSSIPGATPSSSCTPVLSQLQLQMVQSFSTQSGMKIEWSQKCLEENEWNYTRAAQAFI
NLQTQGTIPKEAFQQSV
NT seq 1854 nt   +upstreamnt  +downstreamnt
atgtcatttactcaaaggaagagtggtgcaaaccagcgtgaagaacgcagtggcagcagt
agtgttcatgaaggaagaaagagaagttggggttctttccagggtaatttttctgggagg
aaccttctttatgaacatagtaggcatgagcatttacgttcacaccgccatgatgatgat
ggaactgtagcaatgaggaatgtacaccaggaaccccagttaagacgcactccaaataat
atgcaatacagcaagaggagactgaaatataatcatgaccatgtggatgcgtatggatct
aagaaatgtccagagggagaaatggaggatggaactgtatcatgctggttcaaggtcaca
gttcccaatgggagaaagtataacaagaaatggctgttgagctcaatccagagcgagtcc
actgttcacttcactccggttgattttcattacatcaacaatcaggctcggttctttgtg
cagtattctgacactgcatctgcactgaagaatgtcagccacaagatttgtgatgacgag
aaccgaaagatacctatcttcgtcaaccgctcttctgtaccctactctgtgaagaataag
ttgaagccagaggaaatggagcagctaaagttgaccttgaacaagcgatatgatgcttcc
cggcaagctcttgacctccagaacctccgctttgatccagacttggttggccatgatatt
gatatgattctgaatcgaagacagtgcatggatgccacactgaagatcattgaaggaaat
ttccctgagctgttgtctttgaacttgtgcaacaacaaactgtaccagctggacggcctg
tgtgatattatagagaatgctcctaaagtcaagatcctgaacctctccaacaatgagctg
aagacagcatgtgaattaaacaagctaaaagagctgaatcttgaagagttgtggctagaa
ggcaacccattgtggagaaccttccctaaccactctgcctatgtaagtgccatgcaggac
tgcttccctaatttgttacgcttggatggccgagagattgcctcacctgttgtcattgat
gttggtgctcctaagttagtaaaactctccaaggaaatcccaaaaggaactgaaatgctg
aagagtctcgtcctgcaattcctgcaggagtattacttcatctatgactatggggatcgt
cgtggtctccttggtacttaccatgacaaggcctgcttctccctgaccatgcccttcaac
tccatggacccagtcccgagcggcctgtttgtgtacttacagaacagcaggaatatcaaa
aatgtcacggatccccacttgcgaaggcagctattgaagcacacaagccgtgacatagtg
gatgctctcagtgtgttgccaagaactaaacatgactttagttctttctcaatagacatg
tggttccatacggaaactatgctttgcttttctgtcaacggggtatttaaggaagaaaac
ggttctccggattctgtgtttgccttcacccggaccttcatcgctatccctggcagcact
tccagtctctgcatcacgaatgaccaactgtttgtgaagaacgtcagcagcagcatgttg
cagtgcacctcctccatcccaggagccacaccaagctccagttgcacacccgtactctcc
cagctgcagctgcaaatggtgcagtctttctccacccagtctgggatgaaaattgagtgg
tctcaaaagtgccttgaggagaatgagtggaactacaccagagcagcacaggccttcatt
aacctccagacacagggcacgatcccaaaggaggccttccaacagagtgtctaa

KEGG   Oryctolagus cuniculus (rabbit): 100342837
Entry
100342837         CDS       T03373                                 

Definition
(RefSeq) nuclear RNA export factor 2
  KO
K14284  nuclear RNA export factor
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03008  Ribosome biogenesis in eukaryotes
ocu03013  RNA transport
ocu03015  mRNA surveillance pathway
ocu05014  Amyotrophic lateral sclerosis
ocu05164  Influenza A
ocu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    100342837
   03015 mRNA surveillance pathway
    100342837
   03008 Ribosome biogenesis in eukaryotes
    100342837
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100342837
  09172 Infectious disease: viral
   05164 Influenza A
    100342837
   05168 Herpes simplex virus 1 infection
    100342837
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100342837
   03009 Ribosome biogenesis [BR:ocu03009]
    100342837
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     100342837
   mRNA cycle factors
    Stress granule specific factors
     100342837
Ribosome biogenesis [BR:ocu03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    100342837
SSDB
Motif
Pfam: Tap-RNA_bind TAP_C NTF2 LRR_8
Other DBs
NCBI-GeneID: 100342837
NCBI-ProteinID: XP_008271313
Ensembl: ENSOCUG00000004154
LinkDB
Position
X
AA seq 650 aa
MLPRKDSKLKASNSKVVLQNTESEKQQQEHAVPSMKYENHENKEHNDDASSPDAGRNVES
SFQDTVGDGNVHDKHSRYEHLPSYLNDDGNTAVRNVHRDSQRRCTPYDVRRNKRTVQWRY
DDQIHITVWREKKSLERQNNKDTKDEATDIWFKVMVPYGKNYDKKWLMNSIQSHCAIPFT
PVDFHYVKNQARFFVQDASTAAALAEVSHKICDNEDKKIPIFVSRSVVPYSVQNKLQPEQ
MEQLKLALSKRYDAFQRSLDLQRLRFDRDLVSHNIDMILNRRNCMAATLEVIQSDFSELV
SLNLSSNKLYQLNGLCDIVEKAPKVKILNLSANKLRTAWELEKVKELDLEELWLEGNPLC
RTFPSHAAYVSAIRDCFPKLLRLDGIVLPLPVGVDTNELQLVEPFPEPPKETEMLKSLIL
RFLQEYYFIYDYGDRRSLLRTYHEKACFSLTIPFDPMDPVPSGLCEYFKDSRNMMYLQDP
YLRRQMLKHTNWDIVNTLNVLPRTQHDFISFSMDMWFQMGTALCFSVNGVFKGGSNSWDS
AFIFTRIFITAPRSSSSLCILNDQLFVRDVMPVIHNSSVLGAIPGSNTMADLNQLQQKMV
QAFYMQSGMKLEWSQKCLEDNGWNYIRAKNIFITLLTQSKIPQEAFRHMP
NT seq 1953 nt   +upstreamnt  +downstreamnt
atgctgccgcgaaaagacagcaaactgaaggccagtaattcaaaggtagttctgcaaaac
actgagtctgagaaacagcaacaggaacatgctgtaccatcaatgaaatatgagaaccat
gaaaataaagaacataatgatgatgcgagctctcctgatgcaggaaggaatgttgagagc
tctttccaggatactgttggtgatggaaacgttcatgataaacacagtagatatgagcat
ctgccctcatacctcaatgatgatggaaatacagcagtgaggaatgtccacagggactct
caaaggcggtgcactccttatgatgtgcgtcgcaacaagaggacagtgcaatggcgctat
gatgaccaaatccatattactgtatggagagagaagaaatctctagagagacaaaataat
aaggacacaaaggatgaagccacggatatctggttcaaggtcatggttccatatgggaaa
aattatgacaagaaatggctgatgaattcaatccagagccattgcgctatccccttcact
ccggttgatttccactacgtcaaaaatcaggcccggttctttgtccaggatgctagcact
gctgctgcattggcagaagtcagccacaagatttgtgataatgaggacaaaaagatacct
atttttgtcagccgctctgttgtaccctactctgtgcagaataagttgcagccagaacaa
atggagcagctaaagctggccctgagcaagcgatatgatgctttccagcgatctcttgac
ctccagagactccgttttgaccgagatttggtaagccataatattgacatgatactgaat
cggagaaactgcatggctgctactctggaggtcattcaaagtgatttctctgagctggtg
tctttgaatttgagcagcaacaaactctaccagctgaatggcctgtgtgacattgttgag
aaggcccccaaagtcaagatcctgaacctctctgcaaacaagctgaggacagcatgggaa
ttggagaaagtgaaagagctggatctggaagagctgtggctggaagggaaccccttgtgc
agaaccttccctagccatgctgcctacgtaagtgccatccgagattgtttccccaagttg
ttacgcctggatggcatagtgttacccttgccagttggcgttgacactaatgaactgcag
ttagtagaacccttcccggaacccccaaaagaaactgaaatgctgaagagtttgatcttg
cgcttcctgcaggagtattacttcatctatgactatggagatcgccggagtctccttcgt
acttaccacgagaaggcctgcttctccctgaccattccttttgatcccatggacccagtc
ccgagtggcttatgtgagtatttcaaggacagcaggaatatgatgtatctccaggacccc
tacctgcgaaggcagatgctgaagcacacaaactgggacattgtgaacaccctcaatgtg
ttgcccagaactcagcatgacttcatctccttctcaatggacatgtggttccagatggga
actgcgctctgcttttctgtcaacggggtgttcaagggaggaagtaattcttgggattct
gcatttatcttcacccggatcttcatcactgctcctagaagcagttctagtctgtgcatc
ctgaatgaccagctgtttgtgagagatgtcatgcctgttatccataacagctctgttcta
ggagccatacctggctctaacacaatggccgacctgaaccagctgcaacagaaaatggtg
caggctttctacatgcagtctgggatgaagctcgagtggtctcagaagtgccttgaggac
aacggatggaactacatcagagccaagaatatcttcattaccctcctgacccagagcaag
atcccacaggaggctttcaggcacatgccctag

KEGG   Oryctolagus cuniculus (rabbit): 100347351
Entry
100347351         CDS       T03373                                 

Gene name
NXF1
Definition
(RefSeq) nuclear RNA export factor 1
  KO
K14284  nuclear RNA export factor
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03008  Ribosome biogenesis in eukaryotes
ocu03013  RNA transport
ocu03015  mRNA surveillance pathway
ocu05014  Amyotrophic lateral sclerosis
ocu05164  Influenza A
ocu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    100347351 (NXF1)
   03015 mRNA surveillance pathway
    100347351 (NXF1)
   03008 Ribosome biogenesis in eukaryotes
    100347351 (NXF1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100347351 (NXF1)
  09172 Infectious disease: viral
   05164 Influenza A
    100347351 (NXF1)
   05168 Herpes simplex virus 1 infection
    100347351 (NXF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100347351 (NXF1)
   03009 Ribosome biogenesis [BR:ocu03009]
    100347351 (NXF1)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     100347351 (NXF1)
   mRNA cycle factors
    Stress granule specific factors
     100347351 (NXF1)
Ribosome biogenesis [BR:ocu03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    100347351 (NXF1)
SSDB
Motif
Pfam: Tap-RNA_bind NTF2 TAP_C LRR_4 LRR_8 LRR_9
Other DBs
NCBI-GeneID: 100347351
NCBI-ProteinID: XP_002721042
Ensembl: ENSOCUG00000009503
LinkDB
Position
Un
AA seq 618 aa
MADEGKSYNEYDDRVSFPQRRKKGRGPFRWKYGESNRRSGRGGSGIRSSRLEEDDGDVAM
SDAQDGPRVRYTPYAARPNRRGDTWHGRERIHVTVRRDRAPLERGGAGTSQDGTSKNWFK
ITIPHGRKYDKSWLLNMIQSKCSVPFTPIEFHYENTRAQFFVEDASTASALKAINYKILD
RENKRISIFINSSTPPLTVQSELKPEQVEQLKVIMSKRYDGSQQALDLKGLRSDPDLLAQ
NIDVVLNRRSCMAAALRIIEENIPELLSLNLSDNRLFRLDDMSTLVQKAPNLKILNLSGN
ELKSERELDKIKGLKLEELWLDGNPLCDTFRDQSTYISAIRERFPKLLRLDGHELPPPIA
FDVEAPTLLPPCKGSYFGTENLKSLVLHFLQQYYAIYDSGDRQGLLDAYHDGACCSLSIP
FIPQNPGRSSLAEYFKDSRNVKKLKDPTLRFRLLKHTRLNVVAFLNELPKTQHDVNSFVV
DISAQTNTLLCFSVNGVFKEVDGKSRDSLRAFTRTFIAVPASNSGLCIVNDELFVRNASA
EEIQRAFAMPAPTPSSSPVPTLSPEQQEMLQAFSTQSGMNLEWSQKCLQDNNWDYTRSAQ
AFTHLKAKGEIPEVAFMK
NT seq 1857 nt   +upstreamnt  +downstreamnt
atggcggatgaggggaagtcgtacaacgagtacgatgaccgtgttagtttccctcaaaga
agaaagaaaggccggggtcctttccggtggaagtatggtgagagtaaccgtcgctctgga
agaggtggttctggtatccggtcttcccggcttgaggaggatgatggagatgtagcaatg
agtgacgcccaggatggtccccgagtacgatacaccccctatgctgcccgacccaaccgc
cggggcgacacttggcatggtcgagagcgtattcatgttactgtgcggagagacagagct
cctttagagcgaggaggggccggcaccagccaggatgggacctccaaaaactggttcaag
attacgattcctcatggcagaaagtatgacaagtcatggctcctgaacatgattcagagc
aagtgcagtgtcccattcactcccattgagtttcactatgagaacacacgggctcagttt
tttgtcgaggatgccagtactgcctctgcgttgaaggcgatcaactataaaattctggat
agggagaacaagaggatatccatcttcatcaactcctctaccccacccctcactgtgcag
agtgaactgaagccagaacaagtagagcagctgaaggtgatcatgagcaaacgctatgac
ggctcccagcaagcactggatctcaagggcctgcgttcagacccagatttgttggcccag
aatatcgatgttgtactgaatcgtagaagctgtatggcagctgccttgcgaatcattgaa
gagaatattccagagctcttgtccttgaatttgagtgacaataggctgttcagactggat
gacatgtccaccttggtacagaaggcacccaacctaaagatcctaaacctctccgggaat
gaattgaagtctgagcgagaattagacaagataaaagggctgaagctagaagagctgtgg
cttgatggaaatcccttgtgtgacaccttccgagaccagtccacctacatcagcgccatt
cgtgaacgattccccaagttgttacgcctggatggccatgagttacccccaccaattgcc
tttgatgttgaagccccaacactgttgccaccctgcaagggaagctattttggaacagaa
aacctgaagagtctggtcctgcacttcttgcagcagtattatgcaatttatgactctgga
gaccgacaggggctcctggatgcctatcatgatggggcctgctgttccctgagcattcct
ttcatcccccagaaccccggccgaagcagcttggcagagtacttcaaggatagcagaaat
gtgaagaagcttaaagaccctacactgcggttccgattgctgaagcacacacgtctcaac
gtggttgccttcctcaatgagttgcccaaaactcagcatgacgtcaattcctttgtagta
gacataagcgcccagaccaatacattgctgtgtttttctgtcaacggtgtctttaaggaa
gtggatggaaagtcccgggattctttgcgagcctttactcggacattcattgccgttcct
gccagcaattcagggctgtgtattgtaaatgacgagctatttgtgcggaacgcgagcgct
gaagagatccagagagccttcgccatgccggcccccacaccttcctccagccccgtgccc
accctctccccggagcagcaggaaatgttgcaggcgttctctactcagtctggcatgaac
cttgagtggtctcagaagtgccttcaggacaacaactgggactacaccagatctgcccag
gccttcactcatctcaaggccaaaggtgagatcccagaagtggcattcatgaagtga

KEGG   Oryctolagus cuniculus (rabbit): 103351963
Entry
103351963         CDS       T03373                                 

Definition
(RefSeq) nuclear RNA export factor 2
  KO
K14284  nuclear RNA export factor
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03008  Ribosome biogenesis in eukaryotes
ocu03013  RNA transport
ocu03015  mRNA surveillance pathway
ocu05014  Amyotrophic lateral sclerosis
ocu05164  Influenza A
ocu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    103351963
   03015 mRNA surveillance pathway
    103351963
   03008 Ribosome biogenesis in eukaryotes
    103351963
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    103351963
  09172 Infectious disease: viral
   05164 Influenza A
    103351963
   05168 Herpes simplex virus 1 infection
    103351963
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    103351963
   03009 Ribosome biogenesis [BR:ocu03009]
    103351963
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     103351963
   mRNA cycle factors
    Stress granule specific factors
     103351963
Ribosome biogenesis [BR:ocu03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    103351963
SSDB
Motif
Pfam: TAP_C NTF2 Tap-RNA_bind LRR_4 UBA_4 LRR_8
Other DBs
NCBI-GeneID: 103351963
NCBI-ProteinID: XP_008271322
Ensembl: ENSOCUG00000009877
UniProt: G1SY35
LinkDB
Position
X
AA seq 565 aa
MYSVQEKYGMYQIGECGAVSTLNQGMKKDWDSSHGYLCQENLHYEHNEYKPSPSYHQENN
RIIAIVNTQQDLQLECTPYSMECKKRKKKCNRDKVHGELCRYKKRPNRDMGEEKQDGTLP
CWIKVTFHYINNEAQFFVQDAITESALKECRLLPEEMEQLKLTLNKRYDAYTESLDLQRL
YYDPDLVGHDIDMILNQRHCMAAILHIIEKQFPELFCLNLRNNKLYQLDDLSDIIGKAPK
IKILNLSDNELKMALELQKLKELKLEELWLKGNPLCSTFSDHAAYVSLILDCFPNLLRLD
GRELYPRAVTEIVLMKPCKDSYQGPELLKNLILHFLQQYYFIYDYGDRRTLISVYHEKAC
FSLSTAFHSMDPDPSAFYGYVKNNRNMKDIKDSYLRRKLLKHRNHTIVDALSMLPRTQHD
FNSFSIDMWFHTDTMISFAVNGLFRGESNSQNLMFAFTRTFIVIPSMNSMLCILNDQLFV
RNVNPVNVHTVFTIPGSIPCSSCTPTVSQLQHELEQAFSSLSGMKFEWCRKCLEENGWNY
TRAAQVFLILQMQGKIPKEAFKQIT
NT seq 1698 nt   +upstreamnt  +downstreamnt
atgtattctgttcaagagaagtatgggatgtaccaaattggagaatgtggtgctgttagt
acccttaatcaaggaatgaagaaagattgggattcatcccacggttatttatgccaggag
aatcttcattatgaacataatgagtacaagccttcaccttcataccaccaggagaataat
agaatcatagcaatagtgaatacccaacaggacctacaattagagtgcactccatatagt
atggaatgcaagaagaggaaaaagaaatgtaatcgtgacaaagtccatggagaattgtgc
agatataaaaaacgccccaatagagacatgggggaggagaaacaggatggaactctacca
tgctggatcaaggtcacatttcattacatcaacaacgaggcccagttttttgttcaagat
gctattactgaatctgcactgaaggagtgtcgtttgctgccagaggaaatggagcagcta
aagttgaccttgaacaaacgatatgatgcctacacagaatcccttgatctacagagatta
tattatgatccagacttggtgggccatgatattgacatgatactgaaccaaagacactgc
atggctgccatcctgcatatcattgaaaagcaatttcctgagctgttttgtttgaattta
cgcaacaacaaactgtatcagctggatgacctatctgacatcatagggaaggccccaaaa
atcaagatcttgaacctttctgacaatgagcttaagatggcattggagttacagaagttg
aaagagctaaagcttgaagaattgtggctgaaaggaaaccctttgtgtagcacattcagt
gaccatgctgcctatgtaagtttgattctggattgtttccccaatttgttgcgcctggat
ggcagagagttataccctcgcgctgtcactgaaattgtgttaatgaagccctgcaaggac
agctatcaaggacctgaattactgaaaaatctgatcctgcatttcctgcaacaatattac
tttatttatgactatggagatcgccgtactctcattagtgtttaccatgagaaggcctgc
ttctctctgagcactgccttccactccatggatccagacccgagcgccttctatggctat
gtcaagaacaacaggaatatgaaggatatcaaggattcctacctgagaaggaaattgctt
aagcacagaaaccataccattgtggatgccctcagtatgttgccaagaactcaacatgac
tttaactccttctcaatagacatgtggttccacacggatacgatgatcagttttgctgtt
aatggattattcagaggagaaagtaattctcagaatttgatgtttgccttcacccggact
ttcatcgttatcccaagcatgaattccatgctttgtatcctgaatgatcaactgtttgtg
aggaacgtcaatcctgtcaatgtccatacagtcttcaccatcccaggaagcattccatgc
tccagttgtacacccaccgtttcccagctgcagcatgaattggagcaagctttctcctct
ctgtctgggatgaaatttgagtggtgcaggaagtgccttgaagagaatggatggaactac
accagagcggcacaggtcttccttatcctccagatgcagggcaagatcccaaaggaggcc
ttcaaacaaatcacataa

DBGET integrated database retrieval system