KEGG   Oryctolagus cuniculus (rabbit): 100338850
Entry
100338850         CDS       T03373                                 

Gene name
EIF4EBP1
Definition
(RefSeq) eukaryotic translation initiation factor 4E binding protein 1
  KO
K07205  eukaryotic translation initiation factor 4E binding protein 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01521  EGFR tyrosine kinase inhibitor resistance
ocu03013  RNA transport
ocu04012  ErbB signaling pathway
ocu04066  HIF-1 signaling pathway
ocu04150  mTOR signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04152  AMPK signaling pathway
ocu04211  Longevity regulating pathway
ocu04218  Cellular senescence
ocu04910  Insulin signaling pathway
ocu05163  Human cytomegalovirus infection
ocu05165  Human papillomavirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05221  Acute myeloid leukemia
ocu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    100338850 (EIF4EBP1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100338850 (EIF4EBP1)
   04066 HIF-1 signaling pathway
    100338850 (EIF4EBP1)
   04151 PI3K-Akt signaling pathway
    100338850 (EIF4EBP1)
   04152 AMPK signaling pathway
    100338850 (EIF4EBP1)
   04150 mTOR signaling pathway
    100338850 (EIF4EBP1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100338850 (EIF4EBP1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100338850 (EIF4EBP1)
  09149 Aging
   04211 Longevity regulating pathway
    100338850 (EIF4EBP1)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100338850 (EIF4EBP1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100338850 (EIF4EBP1)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100338850 (EIF4EBP1)
   05163 Human cytomegalovirus infection
    100338850 (EIF4EBP1)
   05165 Human papillomavirus infection
    100338850 (EIF4EBP1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100338850 (EIF4EBP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100338850 (EIF4EBP1)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     100338850 (EIF4EBP1)
SSDB
Motif
Pfam: eIF_4EBP
Other DBs
NCBI-GeneID: 100338850
NCBI-ProteinID: XP_008272227
LinkDB
Position
Un
AA seq 199 aa
MAEQVQREDPSGWAFMNNPLLRTTAQGTPPLAAAGVGWGGAARTTNPRGAYPRRRKGRPG
AELGGRLVREAGGCGAVRGRPCLGAAGCSQTPSRAIPTTRRVVLADGVQLPPGDYSTTPG
GTLFSTTPGGTRIIYDRKFLMECRNSPVAQTPPKDLPTIPGVTSPASDEPPTEASQSHLR
NSPEDKRAGGEESQFEMDI
NT seq 600 nt   +upstreamnt  +downstreamnt
atggcggagcaggtgcagagggaggatcccagtggctgggcttttatgaacaaccctctc
ctgagaaccaccgcccagggcacgcccccactggcggcggccggggttgggtggggcggt
gctgcgcggactacaaatcccaggggcgcgtacccgaggcggcggaaggggcggcctggg
gcggagctaggcgggagacttgtgagggaggcgggaggttgcggggcagtgcgcgggaga
ccatgtctgggggcagcgggctgcagccagaccccgagccgggccatccccaccactcgc
cgggtggtgctcgccgacggcgtgcagctcccgcccggggactacagcaccacccccggc
ggcacgctcttcagcaccactccgggaggcaccaggattatctacgaccggaaattcctg
atggagtgtcggaactcaccagtggcccagacacctccaaaggacctgcccaccattccc
ggggtcaccagccctgccagtgatgagcccccgacggaagccagccagagccacctgcgc
aacagcccggaagacaagcgggcaggcggtgaagagtcacagtttgagatggacatttaa

DBGET integrated database retrieval system