KEGG   Oryctolagus cuniculus (rabbit): 100338854
Entry
100338854         CDS       T03373                                 

Gene name
IFNGR2
Definition
(RefSeq) interferon gamma receptor 2
  KO
K05133  interferon gamma receptor 2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04066  HIF-1 signaling pathway
ocu04217  Necroptosis
ocu04380  Osteoclast differentiation
ocu04630  JAK-STAT signaling pathway
ocu04650  Natural killer cell mediated cytotoxicity
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu05140  Leishmaniasis
ocu05142  Chagas disease
ocu05145  Toxoplasmosis
ocu05152  Tuberculosis
ocu05164  Influenza A
ocu05168  Herpes simplex virus 1 infection
ocu05200  Pathways in cancer
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ocu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100338854 (IFNGR2)
   04066 HIF-1 signaling pathway
    100338854 (IFNGR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100338854 (IFNGR2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100338854 (IFNGR2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100338854 (IFNGR2)
   04658 Th1 and Th2 cell differentiation
    100338854 (IFNGR2)
   04659 Th17 cell differentiation
    100338854 (IFNGR2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100338854 (IFNGR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100338854 (IFNGR2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100338854 (IFNGR2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100338854 (IFNGR2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100338854 (IFNGR2)
  09172 Infectious disease: viral
   05164 Influenza A
    100338854 (IFNGR2)
   05168 Herpes simplex virus 1 infection
    100338854 (IFNGR2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100338854 (IFNGR2)
   05140 Leishmaniasis
    100338854 (IFNGR2)
   05142 Chagas disease
    100338854 (IFNGR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    100338854 (IFNGR2)
Cytokine receptors [BR:ocu04050]
 Interleukin receptor families
  IFN receptor family
   100338854 (IFNGR2)
SSDB
Motif
Pfam: Tissue_fac Interfer-bind fn3
Other DBs
NCBI-GeneID: 100338854
NCBI-ProteinID: XP_008273154
Ensembl: ENSOCUG00000002815
LinkDB
Position
Un
AA seq 351 aa
MRPLLWLPLLPVLLLCGREAAASSPNSLSQLPAPQHPKIRLYNAEQVLSWQPAPLGNGTR
PVVYRVQYKYAMGEWNDVTQVNCTQIAGTECDFTAASLSNGFPMYFNISLRLRAEQGELH
SAWVTVPWFQHYRNVTVGPPRNVRVTPGEGSLIVMCAPPFDISTTMATFQYYVHYWEKAG
IHQVRGPFKSSSILLEDLKPFRVYCLQVEAQLLWVSQNVIRPGHLSNASCLETTADASTK
HQQIILISLGVFSLLLVLAGTCYFLVLKYRGLVKYWFHSPPNIPLQIEEYLKDPDQPILE
ALDNDSSPKDDTWDCVSVISFPAKEPEAGLHVPGTRALAQPWEGSLEPRSC
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgcggccgctgctgtggctgccgctgctaccggtgctgctgctctgcggccgcgaagcc
gcggcgtcctcgccaaactctctttcccagctgcctgctccccagcacccgaagattcgc
ctgtacaacgccgagcaggttctgagttggcagccagcgcccctaggcaatggcacgagg
ccagtggtctacagagtgcagtacaaatacgccatgggggagtggaacgacgtgacccag
gtgaactgcacgcagatcgcagggaccgagtgtgacttcacggcggccagcctctccaac
ggcttcccgatgtatttcaacatctccctgcgcctccgcgcggagcagggggagctccac
tcggcctgggtgacggtgccttggttccaacactatcggaacgtgaccgtcgggcctccc
cggaacgtgcgggtgacccctggagaaggctccctcatcgtcatgtgcgcccctcccttt
gatatcagtaccaccatggccacttttcaatattacgtccactactgggaaaaagcagga
atccatcaggtgagaggtcccttcaagagcagctccattttgctggaggatttgaaaccc
ttcagagtctactgtttgcaagtcgaggcgcaactgctctgggtatcccagaacgtcatc
cggcccgggcatttaagcaacgcatcttgcctggaaacaacagcagatgcctccaccaaa
catcagcaaataatcctgatctcgctgggagtcttttcattgctgttggtactggcaggg
acctgttactttctggtcctcaaatatagaggcctcgtcaaatactggttccactctccg
ccaaacatcccactgcaaatagaagagtatttaaaggacccggatcagcccatcttggag
gccctggacaacgacagctcacccaaggatgacacctgggactgtgtgtccgtcatttca
ttcccagcaaaggagcccgaggcgggtctgcacgtacctggaactagagccctggcccag
ccctgggaaggcagcttggagcccaggagctgctga

KEGG   Oryctolagus cuniculus (rabbit): 100341787
Entry
100341787         CDS       T03373                                 

Gene name
IFNGR1
Definition
(RefSeq) interferon gamma receptor 1
  KO
K05132  interferon gamma receptor 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04066  HIF-1 signaling pathway
ocu04217  Necroptosis
ocu04380  Osteoclast differentiation
ocu04630  JAK-STAT signaling pathway
ocu04650  Natural killer cell mediated cytotoxicity
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu05140  Leishmaniasis
ocu05142  Chagas disease
ocu05145  Toxoplasmosis
ocu05152  Tuberculosis
ocu05164  Influenza A
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05200  Pathways in cancer
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ocu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100341787 (IFNGR1)
   04066 HIF-1 signaling pathway
    100341787 (IFNGR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100341787 (IFNGR1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100341787 (IFNGR1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100341787 (IFNGR1)
   04658 Th1 and Th2 cell differentiation
    100341787 (IFNGR1)
   04659 Th17 cell differentiation
    100341787 (IFNGR1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100341787 (IFNGR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100341787 (IFNGR1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100341787 (IFNGR1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100341787 (IFNGR1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100341787 (IFNGR1)
  09172 Infectious disease: viral
   05164 Influenza A
    100341787 (IFNGR1)
   05168 Herpes simplex virus 1 infection
    100341787 (IFNGR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100341787 (IFNGR1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100341787 (IFNGR1)
   05140 Leishmaniasis
    100341787 (IFNGR1)
   05142 Chagas disease
    100341787 (IFNGR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    100341787 (IFNGR1)
   04090 CD molecules [BR:ocu04090]
    100341787 (IFNGR1)
Cytokine receptors [BR:ocu04050]
 Interleukin receptor families
  IFN receptor family
   100341787 (IFNGR1)
CD molecules [BR:ocu04090]
 Proteins
  100341787 (IFNGR1)
SSDB
Motif
Pfam: IFNGR1 Tissue_fac Interfer-bind
Other DBs
NCBI-GeneID: 100341787
NCBI-ProteinID: XP_008261792
Ensembl: ENSOCUG00000013254
UniProt: G1T516
LinkDB
Position
12
AA seq 471 aa
MALLGLLLLLTKAGSSAGLSTADPEPSSVPKPTSVTVESYNLNPVLYWEYQNMPKTPVFT
VQVKTYESAVWLDACVNISHHYCNIFHQIDDPSSPLWARVKARVGQRESMYAESKEFTLC
KQGKIGPPALNVRKVDNNIAINIFHPLIVINGETLGAMYDEDSACYAFEYHVYIRVKGSE
NTDKKQVSDPCDETQCELSIPVSSLNAEYCISAEGVSGRWHVTTEKSKEVCIAIFNRSIK
DIIWIPVGTAVLLFVIVILVFACYRVKKISPLKRTNIKLPKSLLFVVRNATSETKPDSKY
MSVVTSCQPLVPEDEKVLCEEQLSPEEGPGPHGADCPGSAGHTGDLAEVVAVEEVASDVA
PARPLTPPERENSFHSGSDLSAANSVALNSYHSRNASDSGLAGSGSLSDSEFPTNHKPEI
KPQGQEALPLRNGPSSFGYDKPHVMVDLLVGEHPKEALIGYRLATDAKESS
NT seq 1416 nt   +upstreamnt  +downstreamnt
atggctctcctgggccttctgctgctcctcacgaaggccgggagcagcgctgggctgagc
accgcggatccggagccgtcctcggtgcctaagccaaccagtgttacagttgagtcctat
aacttgaacccagtcctgtattgggagtaccagaacatgccaaagacccctgtttttact
gttcaagtgaagacctatgagagtgcagtgtggcttgatgcctgcgttaatatctctcat
cactactgtaatatttttcaccaaattgatgatccatcaagtcctctgtgggccagagtt
aaagctagggtcggacaaagggaatccatgtatgcagagtcaaaggaattcactttatgt
aaacaaggaaagattggaccacctgcactcaacgttaggaaggtggacaacaacattgct
attaatatatttcatcctctaattgttatcaatggagaaacgctgggagccatgtatgat
gaggacagtgcctgctatgcatttgagtaccatgtgtatataagagtgaagggcagtgag
aacacagataaaaaacaagttagcgacccctgcgatgagacccagtgtgagttaagtata
ccagtgtcctcgctgaacgccgagtattgcatttcagcagaaggcgtctcaggcaggtgg
catgttacaacggagaagtctaaagaagtctgtattgccattttcaatcgtagtataaaa
gatattatttggattcctgttgggactgctgtcctgctgtttgtaatagtgatcctggta
ttcgcatgctatcgcgttaagaagatcagtccacttaagcggacaaacataaagttaccc
aagtccttgctctttgtggtcagaaacgccacatcggagacgaaaccagactcaaaatac
atgtcggttgtcacctcctgccagccgttggtcccggaagacgagaaggtgctctgtgaa
gagcagctgtccccagaggaagggccgggcccgcacggagcagactgcccaggatcagct
gggcacacgggagaccttgctgaagtggtggctgtggaggaggtggcttcggatgtggcc
cctgccaggcccctgactccaccagagagagaaaattctttccattcaggtagcgacctg
tctgcagccaacagcgtcgccttgaactcgtatcactcccgaaatgcctctgacagtggc
cttgcggggtcagggagtctgtcagactcagagttccccacaaatcataaacctgaaata
aagccgcaaggacaagaggccctaccactgagaaacggcccaagctcctttggctacgac
aaaccacatgtgatggtggacctgcttgtgggagagcatcctaaggaggccttgattggt
tacagactcgcaacagatgccaaagaatcctcgtaa

DBGET integrated database retrieval system