KEGG   Oryctolagus cuniculus (rabbit): 100338861
Entry
100338861         CDS       T03373                                 

Gene name
PAPOLA
Definition
(RefSeq) poly(A) polymerase alpha
  KO
K14376  poly(A) polymerase [EC:2.7.7.19]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100338861 (PAPOLA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100338861 (PAPOLA)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.19  polynucleotide adenylyltransferase
     100338861 (PAPOLA)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Poly(A) addition factors
     100338861 (PAPOLA)
SSDB
Motif
Pfam: PAP_central PAP_RNA-bind NTP_transf_2 Polbeta Carla_C4
Other DBs
NCBI-GeneID: 100338861
NCBI-ProteinID: XP_017193566
Ensembl: ENSOCUG00000011531
LinkDB
Position
Un
AA seq 781 aa
MRERTNPTKARARRARAAGRCANVFRASEPGSLAPRHGTVATPFSPVTTQGSQQTQPPQK
HYGITSPISLAAPKETDCILTQKLVETLKPFGVFEEEEELQRRILILGKLNNLVKEWIRE
ISESKNLPQSVIENVGGKIFTFGSYRLGVHTKGADIDALCVAPRHVDRSDFFTSFYDKLN
XQEEVKDLRAVEEAFVPVIKLCFDGIEIDILFARLALQTIPEDLDLRDDSLLKNLDIRCI
RSLNGCRVTDEILHLVPNIDNFRLTLRAIKLWAKRHNIYSNILGFLGGVSWAMLVARTCQ
LYPNAIASTLVHKFFLVFSKWEWPNPVLLKQPEECNLNLPVWDPRVNPSDRYHLMPIITP
AYPQQNSTYNVSVSTRMVMVEEFKQGLAITDEILLSKAEWSKLFEAPNFFQKYKHYIVLL
ASAPTEKQRLEWVGLVESKIRILVGSLEKNEFITLAHVNPQSFPAPKENPDKEEFRTMWV
IGLVFKKTENSENLSVDLTYDIQSFTDTVYRQAINSKMFEVDMKIAAMHVKRKQLHQLLP
NHVLQKKKKHSTEGVKLTALNDSSLDLSMDSDNSMSVPSPTSAMKTSPLNSSGSSQGRNS
PAPAVTAASVTNTQATEVSVPQVNSSESSGGTSSESIPQTATQPAISPPPKPTVSRVVSS
TRLVNPPPRHSGSAPTKVPNPIAGVKRTSSPHKEESPKKTKTEEDETSEDANCLALSGHD
KTETKEQLDTETSTTQSETIQTAASLLASQKTSSTDLSDIPALPANPIPVIKNSIKLRLN
R
NT seq 2346 nt   +upstreamnt  +downstreamnt
atgcgggagcggacgaacccgacaaaagctcgggctcggcgcgcccgggcagccgggcgt
tgtgctaacgtttttcgcgcctcggagccgggctcgctcgcgccccgtcacgggacagtc
gccacacccttcagtccagttacaacgcagggatcacaacaaacacagccgccgcagaag
cactatggcattacttctcccatcagcttagcagcccccaaggagaccgactgcatactc
acacagaaactggttgagaccctgaagccctttggggtttttgaagaggaggaggagctg
cagcgcaggattttaattttgggaaaattaaataacctggttaaagagtggatacgagaa
atcagtgaaagtaagaatcttccgcaatctgtgattgaaaacgttggaggaaaaattttt
acattcggatcttacagattaggagtacatacaaaaggtgccgatattgatgcgttgtgt
gttgcaccaagacatgttgatcgaagtgactttttcacctcattctatgataagttgaat
ntacaagaagaagtaaaagatttaagagctgttgaagaggcatttgtaccagttatcaaa
ctctgttttgatgggatagagattgatattttgtttgcacgattagcactgcagactatt
ccagaagatttggacctacgagatgatagtctgcttaaaaatttagatataagatgcata
agaagtcttaacggttgcagggtaaccgatgaaattttacatctagtaccaaacattgac
aacttcaggttaactctgagagctatcaaactgtgggccaaacgccacaacatctattcc
aatatattaggtttcctcggtggtgtttcctgggctatgctagtagcaagaacttgccag
ctttacccaaatgcaatagcatcaactcttgtacataaatttttcttggtattttctaaa
tgggaatggccaaatccagtgctattgaaacagcctgaagaatgcaatcttaatttgcct
gtatgggacccaagggtaaaccccagtgataggtaccatcttatgcctataattacacca
gcatacccacaacagaactccacgtacaatgtgtccgtttcaacacggatggtcatggtt
gaggagtttaaacaaggtcttgctatcacagatgaaattttgctgagtaaggcagagtgg
tccaaactttttgaagctccaaacttctttcaaaagtacaagcattatattgtacttcta
gcaagtgcaccaacagaaaaacagcgcctagaatgggtgggcttggtggaatcaaaaatc
cgcatcctggttggaagcttggagaagaatgaatttattaccctggcccatgtgaacccc
cagtcatttccagcacccaaagaaaatcctgacaaggaagaatttcgaacgatgtgggtg
attgggttagtgtttaaaaaaacagaaaactctgaaaatctcagtgttgatctcacctat
gatattcagtctttcacagatacagtttataggcaagcaataaacagcaagatgtttgag
gtggatatgaaaattgctgccatgcatgtaaaaagaaagcaactccatcaactgctacct
aatcatgtgcttcagaaaaagaaaaagcattcaacagaaggtgtcaaattgacagctctg
aatgacagcagcctcgacttgtctatggacagtgataacagcatgtctgtgccttcaccc
actagtgctatgaagaccagtccattgaacagttctggcagctctcagggcagaaacagt
cctgctccagctgtgacagcagcatctgtgaccaacacacaggctactgaagtttctgtg
ccacaagtaaattccagtgaaagctcagggggtacatcgagtgaaagcattcctcaaact
gccacacaaccagccatttctccaccaccaaagcctacagtctccagagttgtttcctca
acacgtctggtaaacccaccacctagacattcaggaagtgcaccaacaaaagtacctaat
cctatagcaggagtcaagaggacatcctcccctcataaagaagagagtcccaagaaaacc
aaaacagaagaggatgaaacaagtgaagatgctaactgtcttgctttgagtggacatgat
aaaactgaaacaaaggaacaacttgatacagagacaagtacaacccaatcagaaactatt
cagacagcggcttctctgttggcctctcagaaaacatccagtacagacctttctgatatc
cccgctctccctgcaaatcctattcctgttatcaagaattcaataaaactgagattgaat
cggtaa

KEGG   Oryctolagus cuniculus (rabbit): 100344714
Entry
100344714         CDS       T03373                                 

Gene name
PAPOLG
Definition
(RefSeq) poly(A) polymerase gamma
  KO
K14376  poly(A) polymerase [EC:2.7.7.19]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100344714 (PAPOLG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100344714 (PAPOLG)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.19  polynucleotide adenylyltransferase
     100344714 (PAPOLG)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Poly(A) addition factors
     100344714 (PAPOLG)
SSDB
Motif
Pfam: PAP_central PAP_RNA-bind NTP_transf_2 Nrap_D2 DUF4269
Other DBs
NCBI-GeneID: 100344714
NCBI-ProteinID: XP_002709901
Ensembl: ENSOCUG00000004962
LinkDB
Position
2
AA seq 739 aa
MKEMSANTMLDSQRQQKHYGITSPISLACPKEIDHIYTQKLIDAMKPFGVFEDEEELNHR
LVVLGKLNNLVKEWISDVSESKNLPPSVVATVGGKIFTFGSYRLGVHTKGADIDALCVAP
RHVERSDFFQSFFEKLKHQDGIRNLRAVEDAFVPVIKFEFDGIEIDLVFARLAIQTISDN
LDLRDDSRLRSLDIRCIRSLNGCRVTDEILHLVPNKETFRLTLRAVKLWAKRRGIYSNML
GFLGGVSWAMLVARTCQLYPNAAASTLVHKFFLVFSKWEWPNPVLLKQPEESNLNLPVWD
PRVNPSDRYHLMPIITPAYPQQNSTYNVSTSTRTVMVEEFKQGLAVTDEILQGKSDWSKL
LEPPNFFQKYRHYIVLTASASTEENHLEWVGLVESKIRVLVGNLERNEFITLAHVNPQSF
PGNKEHHKDNNYVSMWFLGIIFRRVENAESVNIDLTYDIQSFTDTVYRQANNINMLKEGM
KIEATHVKKKQLHHYLPAEILQKKKKQSLSDVSRSGLQSKRSSLDSNCLDSSRDTDNGTP
FNSPVSTNKPSKLDSPPAGETERNSVEPAAVIVEKPLSVPPAQGLSIPVIGAKVDSTVKT
ASSPAVCTIPTVVGRNVIPRITTPHNPAQGQPHLNGMSNITKNVTPKRSHSPSIDGTSKR
LKDIEKFIRLESAFKDSRAAEERKRKSLDAIGGESMPIPTIDTSRKKRLPSKELPDSSSP
VPANNIRVIKNSIRLTLNR
NT seq 2220 nt   +upstreamnt  +downstreamnt
atgaaagaaatgtctgcgaacaccatgctggacagccagcgccaacaaaagcactatgga
attacctctccaattagtttggcatgtcctaaagaaattgatcatatttatacacagaaa
ttaattgatgccatgaaaccatttggagtgtttgaagatgaggaagaattaaatcacagg
ctggttgttcttggcaaattgaataatttagtaaaggaatggatttctgacgtcagtgag
agtaagaatctcccaccttcagttgtggctactgttggtggtaaaattttcacatttgga
tcctataggcttggagtacacaccaaaggagctgatattgatgcactttgtgtagctcca
agacatgtagagagatctgatttttttcagtctttttttgaaaaactgaaacatcaagat
ggcattagaaacttaagagctgtagaagatgcctttgtacctgttataaaatttgaattt
gatggtattgaaattgatctagtctttgcaagactggcaatacaaaccatatcagataat
ttagatctaagagatgactctcgcctgagaagccttgacataaggtgtattcgcagccta
aatggatgtagagttactgatgaaattttgcatttagtgccaaataaagaaacttttaga
ctcaccttaagagcagtcaaattatgggcaaaaaggcgtggtatttattccaacatgctt
ggattccttggtggtgtctcctgggctatgctggttgcaagaacttgccagttatatcca
aatgcagcagcttctactttagttcataagttctttttagttttttctaagtgggaatgg
ccaaatcctgtgctgttgaagcagccagaagaaagcaacttgaatttgcctgtctgggat
ccccgggtaaatccatcagataggtatcatctcatgcccataatcacccctgcctaccca
caacagaattctacgtataatgtgtccacatcaactcgaacagtaatggtagaagaattt
aaacaaggtcttgcagtcacagatgaaattcttcaggggaaatcagattggtccaaacta
cttgaaccaccaaatttctttcaaaaatatagacattatatagtgttgactgccagtgca
tcaacagaagaaaaccatctagagtgggttggattagtagaatcaaaaatccgtgtactt
gttggaaacttggaacggaatgaatttattactcttgcccatgtaaatccccagtcattc
ccaggaaataaggaacatcataaagacaacaattacgtgtcaatgtggttcctcggaata
atttttcggagagtagaaaatgcagaaagtgttaacatagacttgacatatgatatacag
tcatttactgatacagtgtacagacaggcaaacaacataaacatgctgaaggaaggaatg
aaaattgaagcaactcatgtaaagaaaaagcagcttcatcactaccttccagcagagatt
cttcaaaaaaagaaaaagcaaagtctctctgacgtcagtcgaagtggacttcaatccaaa
agatcatctctagatagcaattgtctggatagctccagagacactgataatgggacacct
tttaattccccggtatctacaaacaagccttctaaactggatagtcctcctgcaggagaa
acagaaaggaatagtgttgagcctgctgctgtaattgtggagaagccactgagtgttcca
ccagctcaaggactttctattccagtcattggtgcaaaagttgactctacagtaaaaaca
gcatcatccccggctgtgtgtaccattcctactgtggtaggacgaaatgtcattcctcga
attacaacacctcacaaccctgcccagggacaaccacatctaaatggaatgtcaaatata
actaagaatgttacacccaaaagatctcattcaccatccatagatggaacttctaagagg
ttgaaagacatagaaaagtttattcgacttgaatcagcatttaaggactcccgtgctgct
gaagagagaaaaagaaaatcattggatgccattggaggagaatctatgcctattccaact
attgatacatcacgtaaaaagagactacctagtaaagaacttccagattcatcatctcca
gttccagcaaataacatccgtgtcatcaaaaattccatccgactgacacttaatcggtaa

KEGG   Oryctolagus cuniculus (rabbit): 100352625
Entry
100352625         CDS       T03373                                 

Gene name
PAPOLB
Definition
(RefSeq) poly(A) polymerase beta
  KO
K14376  poly(A) polymerase [EC:2.7.7.19]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100352625 (PAPOLB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100352625 (PAPOLB)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.19  polynucleotide adenylyltransferase
     100352625 (PAPOLB)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Poly(A) addition factors
     100352625 (PAPOLB)
SSDB
Motif
Pfam: PAP_central PAP_RNA-bind NTP_transf_2
Other DBs
NCBI-GeneID: 100352625
NCBI-ProteinID: XP_002723110
LinkDB
Position
Un
AA seq 686 aa
MLAPEGKEAKRLRPRARSRVHQGWKSAAPAAASDHAPGGRRGGWGGGGRALAGPALAMMP
FPVPAPGAPAQAPPEKRYGISSPISLAAPKETDCALTQKLIETLRPFGVFEEEEELQSRI
LILEKLNNLVKEWIREISESRSLPEAVVESVGGRLFTFGSYRLGVHTKGADIDALCVAPR
HVDRSDFFTSFYDKLKLREEVRDLRAVEEAFVPVIKLCFDGVEIDILFARLALQTIPEDL
DLRDDSLLKNLDIRCIRSLNGCRVTDEILHLVPDIDNFRLTLRAIKLWAKCHNIYSNILG
FLGGVSWAMLVARTCQLYPNAVASTLVRKFFLVFSEWEWPNPVLLKEPEERNLNLPVWDP
RVNPSDRYHLMPIITPAYPQQNSTYNVSVSTRMVMIEEFKQGLAITHEILLNKAEWSKLF
EAPSFFQKYKHYIVLLASAPTEKQHLEWVGLVESKIRILVGSLEKNEFITLAHVNPQSFP
APKENPDKEEFRTMWVIGLVLKKPENSEILSIDLTYDIQSFTDTVYRQAINSKTFEMDMK
IDAMHLRRKELHQLLPNHVLQKKKHPAEGVRLTAVSDSSLGTDSENSMPVPSPTGLVTGS
CPGRSSPAPAVLSVSLGSSTQPSEVASQPLSPSEGAGAVLSEGGPQTASQPKPTVTRVVS
STCLVSHPPIPAGSAAASIPNPIVGV
NT seq 2061 nt   +upstreamnt  +downstreamnt
atgttggcacctgaggggaaggaggcgaagcgcttgaggccgcgggcgcggagcagggtc
caccagggctggaagagcgccgcccctgccgccgcctcggatcatgccccgggcggccgc
cgcggaggctggggtgggggcggaagggccctggcggggccggcgctagcgatgatgccg
ttcccggtgccggccccgggcgcgccggcgcaggcgccgccggagaagcgctatggcatc
tcgtcgccgatcagcctggccgcccccaaggaaaccgactgcgcgctcacccagaagctg
atcgagaccctgcggcccttcggcgtgttcgaggaggaggaggagctgcagagcaggatt
ttaattctggagaagttaaataatctggtcaaggaatggatacgagaaatcagtgaaagc
aggagccttccggaagccgtggtcgagagcgtgggcggacggctgttcacgttcggctcc
taccggctgggggtgcacaccaagggcgccgacatcgacgcgctgtgcgtggcgcccagg
cacgtggatcgcagcgacttcttcacctccttctatgacaagctgaagctgcgggaagaa
gtcagagacttaagggctgtggaggaggcgtttgtcccagtcataaaactgtgtttcgat
ggggtggagatcgacattttgtttgcgaggttagccctgcagaccattccggaagatctg
gacctgagagacgacagtttgctgaaaaacttagatatcagatgcataagaagtcttaat
ggttgccgggtaactgatgaaattttacatctggtaccagacattgacaacttcaggtta
actctgagagccatcaaattgtgggccaaatgccacaatatctactccaatatattaggt
ttccttggaggcgtctcctgggctatgctggtggcgagaacttgccagctgtatccgaat
gcagtggcatcaactcttgtacgtaagtttttcttggtgttctctgaatgggaatggcca
aacccggtgttgctgaaagagcccgaggagcggaatctgaatttgcctgtttgggacccc
agagtgaaccccagtgataggtaccatctcatgcccataatcaccccggcgtatccccag
cagaactccacctacaacgtgtccgtctccaccaggatggtcatgattgaggagttcaag
caagggcttgctatcacgcatgaaattttgctgaataaggcggagtggtccaaacttttt
gaggctccaagcttctttcaaaagtacaagcattatattgtacttttggcaagtgcgcca
acggaaaaacaacacctggagtgggtgggcttggtggaatccaagattcggatcctggtt
gggagcttggagaagaatgaatttattacgctggcacatgtgaatccacagtcatttccg
gcacccaaggagaaccctgacaaggaggagtttcgcacgatgtgggtgatcgggctagtc
ttaaagaagccagaaaactctgaaattctcagtattgacctcacctatgatattcagtct
ttcacagatacagtgtataggcaggcaatcaatagcaagacgtttgaaatggatatgaaa
attgacgcaatgcatttgagaagaaaagaacttcaccagctgctccccaatcatgtgcta
cagaagaagaagcaccctgctgagggtgtcaggttgacagctgtgagtgacagcagcctc
ggcaccgacagcgagaacagcatgcccgtgccttcgcccactggcctcgtgacgggcagc
tgcccgggcagaagcagccctgccccggctgtcctgtcagtgtctctgggcagcagcacg
cagccctctgaggtcgcctcgcaacccctgagtcccagcgaaggcgctggggctgtgctg
agtgaaggcggccctcagactgcctcacaaccaaagcccaccgtcaccagagtcgtttct
tcaacgtgtctggtgagccatccacccatacctgcaggaagtgcagcagccagcatccct
aaccccatagtaggagtctag

DBGET integrated database retrieval system