KEGG   Oryctolagus cuniculus (rabbit): 100338894
Entry
100338894         CDS       T03373                                 

Gene name
CIITA
Definition
(RefSeq) class II major histocompatibility complex transactivator
  KO
K08060  MHC class II transactivator [EC:2.7.11.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04612  Antigen processing and presentation
ocu05145  Toxoplasmosis
ocu05152  Tuberculosis
ocu05164  Influenza A
ocu05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    100338894 (CIITA)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    100338894 (CIITA)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100338894 (CIITA)
  09172 Infectious disease: viral
   05164 Influenza A
    100338894 (CIITA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100338894 (CIITA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100338894 (CIITA)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:ocu04054]
    100338894 (CIITA)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100338894 (CIITA)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: Other
  TAF1 family
   100338894 (CIITA)
Pattern recognition receptors [BR:ocu04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   100338894 (CIITA)
SSDB
Motif
Pfam: NACHT LRR_6 NLRC4_HD2 LRR_4 LRR_8
Other DBs
NCBI-GeneID: 100338894
NCBI-ProteinID: XP_008255937
Ensembl: ENSOCUG00000006208
LinkDB
Position
6
AA seq 1206 aa
MDHFQAILPRVQMLLSCHGQREVRALLDSLLQEELLSREYHCALLHEPDGEALARKISLT
LLEKRDLDVALLGWARSGWQVPAAERSPEHGDLGGGGSCATMELGPLEGKYLELLNSDVD
PLRLYHFYDQIDLAAGEEMELCSEPYTDTINCEQFSRLLCDIEGDEETREAYANIAELDQ
YVFQDSQLEGLSRDIFIEHMGSDDVVGENAEVPAEAVQKSQKRPFPDECPADPKHRRLAE
PPTVPVVTGSFLVGPVMDSPALPCPPPPALLNQEPARSQTHQEGAVQKPVPPTSSSSNCL
NLPAGPMQLIPTVPALPQWLWQISGAGTGVSSIFIYHSKLPPASQASPPRGPAVHSLPKS
PDRPGSTSPFAPSAAELPSMPEPALTSRTNETEDTVLPTRCQEAPEVSKWPEPVRQLCRS
LQDKFQAEPAGPDGIQVEVDLVRAQLERSGSKSQDRELATLDWAERQLAHGGLAEVLAAS
NPRQPRETQIIAVLGRAGQGKSHWARAVGRAWACGRLPQYDFVFHVPCRCLDRPGDDFRL
CDLLVSPGPPAPAADDEVFGHILRRPERVLLILDAFEEVEAQDSLLHGGAGGPGPTEPCS
LRGLLAGLFQRRLLRGCTLLLTARPRGRLGQSLSKADALYEMTGFSAEQAHAYVVQYFER
CGAPEHQERALALLQERPFLVSHSHSPTVCRATCQLAQALLKQGCGARLPCTLTGLYVDL
LGPAASDGPPGALVALARLAWELGRRHQSSLQESQFPSAELRTWAVARGLVQPAPGAAET
ELAFSSFLLQCFLGAVWLALSSEIKNKELPQYLALTPRKKRPYDNWLEGVPRFLTGLIFQ
PRARCLGALVGPEAAAAVDRKQKVLARYLKRLQPGTLRARRLLELLHCAHEAEEAGIWQH
VVRELPSRLSFLGTRLTPADTHVLARALEAAGRDFSLDLRSTGVDPGGLGSLVGLSHVSS
FRANLSDTVGLWEALQQRGETKLLQAAEEKFTLEPFRAQSLKDVEELGHLVRTQRMGRAS
ADEAGGLPAVRDLKKLEFALGPTLGPQAFPKLVRILTAFCSLQHLDLDSLSENKIGDEGV
AQLSATLPQLKALETLNLSQNSITDLGACTLAEALPALASSLLRLSLYNNCICDAGAESL
AHVLPRMAALRVLDVQYNKFTAAGAQQLAASLRKCPHVETLAMWTPTIPFGVQEHLQQLD
SRISLR
NT seq 3621 nt   +upstreamnt  +downstreamnt
atggaccacttccaggccatcctgcctcgggttcagatgctgctgtcctgccatgggcag
agggaagtgcgggctctcctggacagcctgctacaggaggagcttctctccagggagtac
cactgcgccctgctccacgagcctgatggggaggcgctggccaggaagatctccctgact
ctgctggagaagagagacctggacgtggccctcttaggttgggcccggagcgggtggcag
gttccagcagcagagaggagccctgaacacggggaccttggcggcggcggatcgtgtgcc
accatggaactggggcctctggaagggaagtacctggagcttctcaacagcgatgttgac
cccttgcgcctctaccacttctacgaccagattgacctggctgcgggagaagagatggag
ctgtgctcagaaccctacacggacaccatcaactgcgagcagttcagcaggctgctgtgt
gacattgaaggtgacgaagagaccagggaggcttacgccaacatcgcggaactggaccag
tatgtgttccaggactcccagctggagggcctgagcagagatattttcatagagcacatg
ggatcagatgacgtggttggtgagaacgcagaggtgcccgcggaagcagtacagaaaagt
caaaagagacccttcccggatgagtgcccggcagatccgaagcacaggaggctagctgaa
ccccccactgtgcccgtggtgaccggcagcttcctggtggggccagtgatggactccccc
gctctgccctgcccaccgccacctgccctgctcaaccaggagccagcgcgcagccagacc
caccaggagggagccgtccagaagcctgtgccccccaccagctcctcctcgaactgcctg
aacctccctgctggccccatgcagctcatccccactgtccccgctctgccccagtggctc
tggcaaatctcaggggctgggactggcgtctccagtatattcatctaccacagcaagctg
cccccggccagccaagcgtcccctcccagaggccctgctgtgcacagcctcccgaagtcc
ccagaccggcctggctccaccagccccttcgctccgtctgcagctgagctgcccagcatg
cccgagccagccctgacctcccgcacaaacgagacagaggacactgtgctccccacacga
tgccaagaagccccggaggtctccaaatggcctgagccggtgcggcagctctgccgctcg
ctgcaggacaagttccaggctgagcccgcaggcccggatggcatccaggtggaggtggat
ctggtgcgggcgcagctggagaggagcggcagcaagagccaggacagggaactggccacg
ctggactgggccgagaggcagctggcccacgggggtctggccgaggtgctggctgccagc
aacccccggcagccacgagagacacagatcatcgccgtgctgggcagggccgggcagggc
aagagccactgggcccgggcggtgggccgggcctgggcctgcggccggctgccgcagtac
gacttcgtcttccacgtgccctgccgctgcctggaccgtcccggggacgactttcgcctg
tgcgacctgcttgtgtccccgggcccgccggccccggccgcagacgacgaggtctttggc
cacatcttgaggaggcctgagcgcgtcctgctcatcctggacgccttcgaggaggtggaa
gcccaggacagcctcctgcacggcggcgcgggcggccccgggcccacggagccctgctcc
ctccgggggctgctggccggcctcttccagcgcaggctgctccggggctgcaccctgctc
ctcaccgcccggcctcggggccgcctgggccagagcctgagcaaggccgacgccctgtac
gagatgactggcttctcggccgagcaggcccacgcctacgtggtacaatactttgagcgc
tgcggagccccagagcaccaagagagagccctggcactgctgcaggagcgcccgtttctg
gtcagccacagccacagcccaaccgtgtgccgggcgacgtgccagctcgcacaggccttg
ctgaagcagggctgcggggcccggctgccctgcacgctcacaggactctacgtggacctg
ctgggccctgcggccagcgacggccccccaggggccctggtggcactggccaggctggcc
tgggagctgggccgcagacaccaaagctccctgcaggagagccagttcccgtcggcggag
ctgaggacctgggctgtggccagaggcttggtgcagccagccccaggcgccgcggagacc
gagctggctttctccagcttcctcctgcagtgcttcctgggggctgtgtggctggcgctg
agcagcgagatcaagaacaaggagctgccgcagtacttggcactgaccccgaggaagaag
aggccctacgacaactggctggagggcgtgccgcgcttcctcaccgggctgatcttccag
ccccgcgcccgctgcctgggagccctggtggggccagaggcagccgccgcggtggaccgg
aagcagaaggtgctcgccaggtacttgaagcggctgcagccagggacgctgagggcgcgg
cggctgctcgagctgctgcactgcgcccacgaggccgaggaggccgggatctggcagcac
gtggtgcgcgagctcccctcccgcctctccttcctgggcacgcggctcacgcccgctgac
acacacgtgctggcccgggccttggaggccgccggccgggacttctctctggacctccgc
agcaccggtgtggaccccggcggactgggcagcctcgtgggactcagccacgtcagcagc
ttcagggccaacttgagcgacacggtggggctgtgggaggccctgcagcagcgtggggag
accaagctactccaggcagcggaagagaaattcaccctggagcctttcagggcccagtct
ctgaaggatgtggaggagctcggccacctcgtgcggacccagaggatgggacgcgcctct
gcagacgaagccggcggactccccgccgtccgggacctgaagaagctggagtttgcgttg
ggccccaccttgggcccccaggcctttcccaaactggtgaggatcctcacggccttctgc
tcgctgcagcacctggacctggactccctgagcgagaacaagatcggggacgagggcgtc
gcacagctgtcggccaccctccctcagctgaaggccctggagacgctcaacctgtctcag
aacagcatcaccgacctgggcgcctgcacgctcgccgaggccctgcccgcgctcgccagc
tccctcctcaggctgagcttgtacaataactgcatctgcgacgcgggagccgagagcctg
gcgcacgtacttccacgcatggcggccctgcgggtgctggatgtccagtacaacaagttc
acggccgccggggcccagcagctcgccgccagcctgaggaagtgccctcatgtggagacg
ctggcgatgtggacgcccaccatcccattcggcgtccaggagcacctgcagcagctggac
tcccggatcagcctgcgatga

DBGET integrated database retrieval system