KEGG   Oryctolagus cuniculus (rabbit): 100339011Help
Entry
100339011         CDS       T03373                                 

Gene name
GAD2
Definition
(RefSeq) glutamate decarboxylase 2
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00250  Alanine, aspartate and glutamate metabolism
ocu00410  beta-Alanine metabolism
ocu00430  Taurine and hypotaurine metabolism
ocu00650  Butanoate metabolism
ocu01100  Metabolic pathways
ocu04727  GABAergic synapse
ocu04940  Type I diabetes mellitus
Module
ocu_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    100339011 (GAD2)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100339011 (GAD2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100339011 (GAD2)
   00430 Taurine and hypotaurine metabolism
    100339011 (GAD2)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    100339011 (GAD2)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    100339011 (GAD2)
Enzymes [BR:ocu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     100339011 (GAD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 100339011
NCBI-ProteinID: XP_002717351
Ensembl: ENSOCUG00000017480
UniProt: G1TDS5
LinkDB All DBs
Position
16
AA seq 585 aa AA seqDB search
MASPGSGFWSFGTEDGSGDPENPGTARAWCQVAQKFTGGIGNKLCALLYGDTEKPADSGG
NQPSRAPARKAACACDQKPCSCPKADVNYAFLHATDLLPAFGGERPTLAFLQEVVDILLQ
YVVKSFDRSTKVIDFHYPNELLQEYNWELAEHPQNLEEILMHCQTTLKYAIKTGHPRYFN
QLSTGLDMVGLAADWLTSTANTNMFTYEIAPVFVLLEYVTLKKMREIIGWPGGSGDGIFS
PGGAISNMYAMLIARFKMFPEVKEKGMAAVPRLIAFTSEHSHFSLKKGAAALGIGTDSVI
LIKCDERGKMIPSDLERRILEAKQKGFVPFLVSATAGTTVYGAFDPLLAVADICKKYKIW
MHVDAAWGGGLLMSRKHKWKLSGVERANSVTWNPHKMMGVPLQCSALLVREEGLMQSCNQ
MHASYLFQQDKHYDLSYDTGDKALQCGRHVDVFKLWLMWRAKGTAGFEAHIDKCLELAEY
LYNIIKNREGYEMVFDGKPQHTNVCFWYVPPSLRVLDDNEERMSRLSKVAPVIKARMMEY
GTTMVSYQPLGDKVNFFRMVISNPAATHQDIDFLIEEIERLGQDL
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggcatctccgggctccggcttctggtccttcgggactgaagatggctccggagacccc
gagaaccctggcacagcgagagcctggtgccaggtggcccagaagttcacgggcggcatc
ggaaacaagctgtgcgcgctgctctacggggacaccgagaagccagccgacagcggcggg
aaccagccctcgcgggcccccgcccggaaggccgcctgtgcctgcgaccagaagccctgc
agctgccccaaagcggacgtcaactacgcctttctgcacgcaacagacctgctgcccgcc
ttcgggggcgagaggcccaccctcgcctttctgcaagaggttgtggacattctgcttcag
tacgtggtgaaaagttttgatcgatccaccaaagtgatcgatttccattatcccaatgag
cttcttcaagagtataattgggaactggcagagcacccacaaaatttggaggaaattttg
atgcattgccaaacaactctaaaatatgcaattaaaacagggcatccccgatatttcaat
caactgtccactggcttggatatggttggattagcagcagactggctgacatcaacagcc
aacactaacatgttcacctatgaaatcgctcctgtatttgtgcttttggaatatgtcacg
ctaaagaaaatgagagaaatcattggctggccagggggctctggcgatgggatattttct
cctggtggcgccatatcgaacatgtacgccatgctgatcgcgcgctttaagatgttcccg
gaagtcaaggagaaaggaatggctgctgtccccaggctcatcgccttcacgtcggagcat
agtcatttttctctgaagaagggagctgcagccttagggattggaacagacagcgtgatt
ctgatcaaatgcgacgagagagggaaaatgatcccctccgatcttgaaagaagaatcctg
gaagccaaacaaaagggattcgttcctttcttggtgagtgccacggcgggcaccaccgtg
tatggagcgttcgaccccctcctggctgtggctgacatttgcaagaagtataagatctgg
atgcacgtggacgccgcctggggcgggggattactgatgtcccggaaacacaagtggaaa
ctgagtggcgtggagagggccaactctgtgacgtggaatccacacaagatgatgggggtc
ccactgcagtgttctgctctcctggttagagaagagggtttgatgcagagttgcaaccag
atgcacgcttcctacctctttcagcaggacaaacactacgacctgtcctacgacaccggg
gacaaggccttgcagtgcgggcgccacgtggatgttttcaaactatggctcatgtggagg
gcaaaggggactgctgggttcgaggcacatattgataagtgtttggagctggcggagtac
ttatacaacatcataaaaaaccgagaaggctatgagatggtgtttgatgggaagccccag
cacacaaatgtctgcttctggtacgtccctccaagtctgcgtgttctggatgacaatgaa
gagagaatgagccgcctctcgaaggtggccccggtgatcaaagccagaatgatggagtac
gggaccacgatggtcagctaccagcccctgggagacaaggtcaacttcttccgcatggtc
atctcaaaccccgcggccactcatcaagacatcgacttcctcatcgaagagatagaacgc
ctcgggcaagacctataa

DBGET integrated database retrieval system