KEGG   Oryctolagus cuniculus (rabbit): 100339093
Entry
100339093         CDS       T03373                                 

Gene name
EIF2S1, EIF2A, eIF-2A, eIF-2alpha
Definition
(RefSeq) eukaryotic translation initiation factor 2 subunit alpha
  KO
K03237  translation initiation factor 2 subunit 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03013  RNA transport
ocu04140  Autophagy - animal
ocu04141  Protein processing in endoplasmic reticulum
ocu04210  Apoptosis
ocu04932  Non-alcoholic fatty liver disease
ocu05010  Alzheimer disease
ocu05012  Parkinson disease
ocu05014  Amyotrophic lateral sclerosis
ocu05020  Prion disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05160  Hepatitis C
ocu05162  Measles
ocu05164  Influenza A
ocu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    100339093 (EIF2S1)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100339093 (EIF2S1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100339093 (EIF2S1)
  09143 Cell growth and death
   04210 Apoptosis
    100339093 (EIF2S1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100339093 (EIF2S1)
   05012 Parkinson disease
    100339093 (EIF2S1)
   05014 Amyotrophic lateral sclerosis
    100339093 (EIF2S1)
   05020 Prion disease
    100339093 (EIF2S1)
   05022 Pathways of neurodegeneration - multiple diseases
    100339093 (EIF2S1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100339093 (EIF2S1)
  09172 Infectious disease: viral
   05162 Measles
    100339093 (EIF2S1)
   05164 Influenza A
    100339093 (EIF2S1)
   05160 Hepatitis C
    100339093 (EIF2S1)
   05168 Herpes simplex virus 1 infection
    100339093 (EIF2S1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:ocu03012]
    100339093 (EIF2S1)
Translation factors [BR:ocu03012]
 Eukaryotic type
  Initiation factors
   eIF-2
    100339093 (EIF2S1)
SSDB
Motif
Pfam: EIF_2_alpha S1 SoDot-IcmSS DUF4453
Other DBs
NCBI-GeneID: 100339093
NCBI-ProteinID: XP_002719561
Ensembl: ENSOCUG00000012023
LinkDB
Structure
PDB: 
5K0Y

Position
20
AA seq 315 aa
MPGLSCRFYQHKFPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRRIRSIN
KLIRIGRNECVVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLE
YTKDEQLESLFQRTAWVFDDKYKRPGYGAYDAFKHAVSDPSILDSLDLNEDEREVLINNI
NRRLTPQAVKIRADIEVACYGYEGIDAVKEALRAGLNCSTETMPIKINLIAPPRYVMTTT
TLERTEGLSVLNQAMAVIKEKIEEKRGVFNVQMEPKVVTDTDETELARQLERLERENAEV
DGDDDAEEMEAKAED
NT seq 948 nt   +upstreamnt  +downstreamnt
atgccaggtctaagttgtagattttatcaacacaaatttcctgaggtggaagatgtagtg
atggtgaatgtaagatccattgctgaaatgggggcttacgtcagcttgttggaatacaac
aacattgaaggcatgattcttctcagtgaattatccaggaggcgtattcgttccataaac
aaactcatccgaatcggcaggaatgaatgtgtggttgtcattagagtggacaaagaaaaa
ggatatattgacttgtccaaaagaagagtttctccggaggaggcaatcaaatgtgaagac
aaattcacaaaatctaaaactgtgtatagcattcttcgtcatgttgctgaggtgttagaa
tacaccaaggatgagcaactggaaagcctgttccagagaactgcgtgggtctttgatgat
aagtacaagagacctggatacggtgcctacgatgcgtttaaacatgcagtatcagatcca
tctattttggatagtttagatttgaatgaagatgaacgggaagtactcattaataatatt
aataggcgtttgaccccacaggctgtgaaaattcgagcagatattgaagtggcgtgttat
ggttatgaaggcattgatgctgtgaaagaagccctgagagcaggtttgaattgttctacg
gaaaccatgcccatcaaaattaatctaatagctcctcctcgatacgtgatgactacaaca
accctagagagaacagaaggtctctctgtcctcaatcaagctatggctgttatcaaagag
aagatcgaggaaaagaggggagtgtttaatgttcaaatggagcccaaagtggtcacagat
acagatgagactgaacttgcaaggcagctggagaggctcgagagagaaaatgcggaagtg
gatggagatgacgatgcagaagaaatggaagcgaaagctgaagattaa

DBGET integrated database retrieval system