KEGG   Oryctolagus cuniculus (rabbit): 100339216
Entry
100339216         CDS       T03373                                 

Gene name
TCF7
Definition
(RefSeq) transcription factor 7 (T-cell specific, HMG-box)
  KO
K02620  transcription factor 7
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04310  Wnt signaling pathway
ocu04390  Hippo signaling pathway
ocu04520  Adherens junction
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04916  Melanogenesis
ocu04934  Cushing syndrome
ocu05132  Salmonella infection
ocu05165  Human papillomavirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05200  Pathways in cancer
ocu05210  Colorectal cancer
ocu05213  Endometrial cancer
ocu05215  Prostate cancer
ocu05216  Thyroid cancer
ocu05217  Basal cell carcinoma
ocu05221  Acute myeloid leukemia
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
ocu05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100339216 (TCF7)
   04390 Hippo signaling pathway
    100339216 (TCF7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100339216 (TCF7)
   04550 Signaling pathways regulating pluripotency of stem cells
    100339216 (TCF7)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100339216 (TCF7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100339216 (TCF7)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100339216 (TCF7)
   05225 Hepatocellular carcinoma
    100339216 (TCF7)
   05226 Gastric cancer
    100339216 (TCF7)
   05216 Thyroid cancer
    100339216 (TCF7)
   05221 Acute myeloid leukemia
    100339216 (TCF7)
   05217 Basal cell carcinoma
    100339216 (TCF7)
   05215 Prostate cancer
    100339216 (TCF7)
   05213 Endometrial cancer
    100339216 (TCF7)
   05224 Breast cancer
    100339216 (TCF7)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100339216 (TCF7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100339216 (TCF7)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100339216 (TCF7)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100339216 (TCF7)
   05165 Human papillomavirus infection
    100339216 (TCF7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    100339216 (TCF7)
Transcription factors [BR:ocu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    100339216 (TCF7)
SSDB
Motif
Pfam: HMG_box CTNNB1_binding HMG_box_2 DUF3621
Other DBs
NCBI-GeneID: 100339216
NCBI-ProteinID: XP_008253229
LinkDB
Position
3
AA seq 456 aa
MRRLGRHPKLAPGRRCPQSPGTPRHPGRRPPRPRSAPGAHHAAAGRRRGRRGRRRRPRRA
RRAAGLPGRGRGAGQEPRQRRGPRARPGRAQVVARERVRGRCGRRWGPGARRRGRSGGGG
ARARARSAEAVPGQARRVPGGRPEVPRVRRRHVQGDRVLCLQPAHALPARAGGRAAPAPA
AAAPLHNKASQPPHGVPQLSPLYEHFSNPHSTPAPADISQKQGVPRPLQTPDLSGFYSLT
SGSVGQLPHTVSWPSPPLYPLSPSCGYRQHFPAPTAAPGAPYPRFTHPSLVLGSGVPGHP
AAIPHPAIVPPSGKQELQPYDRSLKTQGESKAEKEVKKPTIKKPLNAFMLYMKEMRAKVI
AECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKRR
SREKHQESTTGGKRNAFGTYPEKAAAPAPFLPMTVL
NT seq 1371 nt   +upstreamnt  +downstreamnt
atgcgtcgccttggacgccaccccaagcttgccccgggacgcagatgtccccagagcccg
ggcaccccgcggcaccctggacgccgccccccgcgcccccggagcgcccccggagcgcac
catgccgcagctggacgccggcgggggcggcgcgggcggcggcgacgacctcggcgcgcc
cgacgagctgctggccttccaggacgagggcgaggagcaggacaagagccgcgacagcgc
cgcgggccccgagcgcgacctggccgagctcaagtcgtcgctcgtgaacgagtccgaggg
cgctgcgggcggcgctgggggcccggggcccggcgccgaggccgaagtggcggcggaggc
gctcgggcgcgagcacgctccgcagaggctgttcccggacaagctcgccgagtccctgga
ggaaggcctgaagtcccccgagtgcgccggcgccatgtacaaggagaccgtgtactctgc
cttcaacctgctcatgcactacccgcccgcgccgggggccgggcagcacccgcacccgca
gccgcagccccgctgcacaacaaggccagtcagcccccccatggtgtcccccaactgtct
cctctctatgaacatttcagcaacccacactccacacctgcacccgcggacatcagccag
aagcaaggcgttcccagacctctgcagacccctgacctctccggcttctactcgctgacc
tcaggcagcgtgggacagctcccgcacactgtgagctggcccagccctcctctctacccc
ctgtccccttcctgcggatatagacagcacttccctgcccccactgcagcccctggcgcc
ccctaccccaggttcactcacccatccttggtgctgggctctggtgtacctggtcaccct
gcagccatcccccaccctgccattgtgcctccctcaggaaagcaggagctgcagccctat
gaccgcagcctgaagacacagggtgaatccaaggcagagaaggaagtgaagaagccaacc
atcaagaaacccctcaatgcctttatgctgtacatgaaggagatgagagccaaggtcatc
gcagagtgtacactgaaggagagtgctgccatcaaccagattttgggccgcaggtggcat
gcactgtcgcgggaagagcaggcaaaatattatgagctggcccgcaaggagaggcagcta
cacatgcaattatatccaggctggtcggcgcgggacaactacggaaagaagaagaggcgg
tcaagagaaaagcaccaagaatccaccacaggaggaaaaagaaatgcattcggtacttac
ccggagaaggccgctgccccagccccgttccttccgatgacagtgctctag

KEGG   Oryctolagus cuniculus (rabbit): 100340471
Entry
100340471         CDS       T03373                                 

Gene name
TCF7L1
Definition
(RefSeq) transcription factor 7 like 1
  KO
K04490  transcription factor 7-like 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04310  Wnt signaling pathway
ocu04390  Hippo signaling pathway
ocu04520  Adherens junction
ocu04916  Melanogenesis
ocu04934  Cushing syndrome
ocu05132  Salmonella infection
ocu05165  Human papillomavirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05200  Pathways in cancer
ocu05210  Colorectal cancer
ocu05213  Endometrial cancer
ocu05215  Prostate cancer
ocu05216  Thyroid cancer
ocu05217  Basal cell carcinoma
ocu05221  Acute myeloid leukemia
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
ocu05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100340471 (TCF7L1)
   04390 Hippo signaling pathway
    100340471 (TCF7L1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100340471 (TCF7L1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100340471 (TCF7L1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100340471 (TCF7L1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100340471 (TCF7L1)
   05225 Hepatocellular carcinoma
    100340471 (TCF7L1)
   05226 Gastric cancer
    100340471 (TCF7L1)
   05216 Thyroid cancer
    100340471 (TCF7L1)
   05221 Acute myeloid leukemia
    100340471 (TCF7L1)
   05217 Basal cell carcinoma
    100340471 (TCF7L1)
   05215 Prostate cancer
    100340471 (TCF7L1)
   05213 Endometrial cancer
    100340471 (TCF7L1)
   05224 Breast cancer
    100340471 (TCF7L1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100340471 (TCF7L1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100340471 (TCF7L1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100340471 (TCF7L1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100340471 (TCF7L1)
   05165 Human papillomavirus infection
    100340471 (TCF7L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    100340471 (TCF7L1)
Transcription factors [BR:ocu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    100340471 (TCF7L1)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 100340471
NCBI-ProteinID: XP_008252404
Ensembl: ENSOCUG00000008749
LinkDB
Position
2
AA seq 520 aa
MSRRTRAAALNSEAERRPQPSRDAFQKPRDYFAEVRRPQDGAFFKGPPYPGYPFLMIPDL
SSPYLSNGPLSPGGARTYLQMKWPLLDVPSSATVKDARSPSPAHLSNKVPVVQHPHHMHP
LTPLITYSNDHFSPGSPPTHLSPEIDPKTGIPRPPHPSELSPYYPLSPGAVGQIPHPLGW
LVPQQGQPMYSLPPGGFRHPYPALAMNASMSSLVSSRFSPHMVAPAHPGLPTSGIPHPAI
VSPIVKQEPAPPSLSPAVSAKSPVTVKKEEEKKPHVKKPLNAFMLYMKEMRAKVVAECTL
KESAAINQILGRKWHNLSREEQAKYYELARKERQLHSQLYPTWSARDNYGKKKKRKREKQ
LSQTQTQSQQHVQEAEGALASKSKKPCVQYLPPEKPCDSPASSHGSMLDSPATPSAALAS
PAAPAATHSEQAQPLSLTTKPETRAQLALHSAAFLSAKAAATSPGQMGSQPPLLSRPLPL
GSVPTALLTSPPSFPATLHAHQTLPVLQAQPLSLVTKSAH
NT seq 1563 nt   +upstreamnt  +downstreamnt
atgagtcggagaaccagagcagcagctctgaactcggaggcggagaggcgcccgcagccc
tcccgggacgctttccagaagccgcgggactatttcgccgaagtgagaaggccccaggac
ggcgcgttcttcaagggccccccttaccctgggtaccccttcctgatgatcccggacctg
agcagcccctacctctccaacggacccctgtctccgggaggagcgcgcacgtacctgcag
atgaaatggcccctcctcgacgtcccctctagtgccacagtcaaggacgcgaggtcaccg
tctccggcacacttgtccaataaagttcctgttgtgcagcacccgcatcacatgcacccg
ttgacaccgctcatcacctacagcaatgaccacttctcccccggctccccgccgacgcac
ctctccccggagatcgatccaaagacaggaattccccggccccctcacccgtccgagctg
tcaccgtattacccactgtccccgggagctgtcggacaaatcccccacccactcggctgg
ctcgtcccacagcaaggacagcccatgtactcccttccgcctggtggcttccggcaccct
taccctgccctcgccatgaatgcctcgatgtccagcctggtttccagccgcttctcccct
cacatggtggcccccgcccatcctggcctgcccacctcagggatcccgcaccccgccatc
gtctccccgattgtcaagcaggagccagcaccgcccagcctgagccccgcggtgagcgcg
aagtcacccgtgaccgtgaagaaggaggaggagaagaaaccccacgtgaagaagcccctg
aatgccttcatgttgtatatgaaggagatgagggccaaggtggtggccgagtgcaccctg
aaggagagtgccgccatcaaccagatcctggggaggaagtggcacaacctgtcgcgggaa
gaacaggccaagtactacgagctggcccggaaagagcggcagcttcactcccagctctac
ccgacctggtcggcccgggacaactacggtaagaaaaagaagaggaagcgagagaagcag
ctgtcgcagacgcagacgcagtcccagcagcacgtccaagaggcagagggtgccctggcc
tccaagagcaagaagccatgtgtccagtacctgccccccgagaagccctgcgacagccct
gcctcctcccacggcagcatgttggactcccctgccaccccctccgcggccttggcctca
ccagctgcccctgctgccacccactccgagcaagcccagccactgtccctcaccaccaag
ccagagacccgggcccagctggctctgcactcggctgccttcctgtcagccaaggctgca
gccacgtcccccggccagatgggcagccagcctcccctcctgtcccggcccctcccactg
gggtccgtgcccaccgctctgctgacctctcccccctctttcccagccacgctccacgcc
caccagaccctccccgtactccaggcccagcctctttccttggtcaccaagtctgcccac
taa

KEGG   Oryctolagus cuniculus (rabbit): 100352691
Entry
100352691         CDS       T03373                                 

Gene name
LEF1
Definition
(RefSeq) lymphoid enhancer binding factor 1
  KO
K04492  lymphoid enhancer-binding factor 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04310  Wnt signaling pathway
ocu04390  Hippo signaling pathway
ocu04520  Adherens junction
ocu04916  Melanogenesis
ocu04934  Cushing syndrome
ocu05132  Salmonella infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05200  Pathways in cancer
ocu05210  Colorectal cancer
ocu05213  Endometrial cancer
ocu05215  Prostate cancer
ocu05216  Thyroid cancer
ocu05217  Basal cell carcinoma
ocu05221  Acute myeloid leukemia
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
ocu05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100352691 (LEF1)
   04390 Hippo signaling pathway
    100352691 (LEF1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100352691 (LEF1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100352691 (LEF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100352691 (LEF1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100352691 (LEF1)
   05225 Hepatocellular carcinoma
    100352691 (LEF1)
   05226 Gastric cancer
    100352691 (LEF1)
   05216 Thyroid cancer
    100352691 (LEF1)
   05221 Acute myeloid leukemia
    100352691 (LEF1)
   05217 Basal cell carcinoma
    100352691 (LEF1)
   05215 Prostate cancer
    100352691 (LEF1)
   05213 Endometrial cancer
    100352691 (LEF1)
   05224 Breast cancer
    100352691 (LEF1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100352691 (LEF1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100352691 (LEF1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100352691 (LEF1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100352691 (LEF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    100352691 (LEF1)
Transcription factors [BR:ocu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    100352691 (LEF1)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 100352691
NCBI-ProteinID: XP_002717217
Ensembl: ENSOCUG00000010436
UniProt: G1SZ98
LinkDB
Position
15
AA seq 399 aa
MPQLSGGGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNE
SEIIPASNGHEVARQAQASQESYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNM
NNDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGTHPSHIPSDVNS
KQGMSRHPAAPDIPTFYPLSPGGVGQITPPLGWQGQPVYPISGGFRQPYPSSLSVDTSMS
RFSHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIK
KPLNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHM
QLYPGWSARDNYGKKKKRKREKLQESTSGTGPRMTAAYI
NT seq 1200 nt   +upstreamnt  +downstreamnt
atgccccagctctccgggggaggcggcggcggcgggggggacccggaactctgcgccacg
gacgagatgatccccttcaaggacgagggcgatccccagaaggagaagatctttgccgag
atcagtcaccctgaagaggaaggcgacttggccgacatcaagtcctccttagttaacgag
tctgagatcatcccggccagcaacggacacgaggtggccagacaagctcaagcctcccag
gagtcctaccacgacaaggccagagaacatcctgatgatgggaagcatccagatggaggc
ctttacaacaagggaccctcctactcaagttattctgggtacataatgatgccaaatatg
aacaacgacccatacatgtcaaatggatccctttctccacccatcccgagaacatcaaac
aaagtgcccgtggtgcagccctcccatgcagtccatcctctcacccccctcatcacctac
agcgacgagcacttttctccaggaacacacccgtcacacatcccatcagatgtcaactcc
aaacaaggcatgtccagacatcctgcagctcctgacatccctaccttttaccccctgtct
cctggtggtgttggccagattaccccacctcttggctggcaaggtcagcctgtatatccc
atctcgggtggattcaggcaaccctacccgtcctcactgtcagtcgacacttccatgtcc
aggttttcccatcacatgattcctggtcctcctggtccccacacaactggcatccctcat
ccagctattgtgacacctcaggtcaaacaggagcacccccacactgacagcgacctaatg
cacgtgaagcctcagcatgaacagagaaaggagcaggagccaaaaagacctcacattaag
aagcctctgaacgcttttatgttatacatgaaagaaatgagagcaaatgtcgtagctgag
tgtactctaaaagaaagtgcagctatcaaccagatcctaggcagaaggtggcatgccctc
tcccgtgaggaacaggctaaatattatgaattagcacggaaagaaagacagctacatatg
cagctttatccaggctggtccgcaagagacaattatggtaagaaaaagaagaggaagaga
gagaaactacaggaatctacatcaggtacaggtccaagaatgacagctgcctacatctga

KEGG   Oryctolagus cuniculus (rabbit): 100358378
Entry
100358378         CDS       T03373                                 

Gene name
TCF7L2
Definition
(RefSeq) transcription factor 7 like 2
  KO
K04491  transcription factor 7-like 2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04310  Wnt signaling pathway
ocu04390  Hippo signaling pathway
ocu04520  Adherens junction
ocu04916  Melanogenesis
ocu04934  Cushing syndrome
ocu05132  Salmonella infection
ocu05165  Human papillomavirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05200  Pathways in cancer
ocu05210  Colorectal cancer
ocu05213  Endometrial cancer
ocu05215  Prostate cancer
ocu05216  Thyroid cancer
ocu05217  Basal cell carcinoma
ocu05221  Acute myeloid leukemia
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
ocu05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100358378 (TCF7L2)
   04390 Hippo signaling pathway
    100358378 (TCF7L2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100358378 (TCF7L2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100358378 (TCF7L2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100358378 (TCF7L2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100358378 (TCF7L2)
   05225 Hepatocellular carcinoma
    100358378 (TCF7L2)
   05226 Gastric cancer
    100358378 (TCF7L2)
   05216 Thyroid cancer
    100358378 (TCF7L2)
   05221 Acute myeloid leukemia
    100358378 (TCF7L2)
   05217 Basal cell carcinoma
    100358378 (TCF7L2)
   05215 Prostate cancer
    100358378 (TCF7L2)
   05213 Endometrial cancer
    100358378 (TCF7L2)
   05224 Breast cancer
    100358378 (TCF7L2)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100358378 (TCF7L2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100358378 (TCF7L2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100358378 (TCF7L2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100358378 (TCF7L2)
   05165 Human papillomavirus infection
    100358378 (TCF7L2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    100358378 (TCF7L2)
Transcription factors [BR:ocu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    100358378 (TCF7L2)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 100358378
NCBI-ProteinID: XP_002718796
Ensembl: ENSOCUG00000008142
LinkDB
Position
18
AA seq 604 aa
MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSAAERDLADVKSSLVNESETNQNSSS
DSEAERRPPPRSESFRDKSRESLEEAAKRQDGGLFKGPPYPGYPFIMIPDLTSPYLPNGS
LSPTARTLHFQSGSTHYSAYKTIEHQIAIQYLQMKWPLLDVQAGGLQSRQALKDARSPSP
AHIVSNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDIS
PYYPLSPGTVGQIPHPLGWLVPQQGQPVYPITTGGFRHPYPTALTVNASMSRFPPHMVPP
HHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPHIKKPLNAFMLY
MKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSAR
DNYGKKKKRKRDKQPGETNDANTPKKCRALFGLDRQTLWCKPCRRKKKCVRYIQGEGSCL
SPPSSDGSLLDSPPPSPHLLGSPPPDAKSQTEQTQPLSLSLKPDPLAHLAMMPPPPALLL
AEAAHGKASALCPNGALDLPPAALQPPIVASSSLAQPSTSSLHSHSSLAGTQPQPLSLVT
KSLE
NT seq 1815 nt   +upstreamnt  +downstreamnt
atgccgcagctgaacggcggtggaggagatgacctaggcgccaacgacgaactgatttcc
ttcaaagacgagggcgagcaggaggagaagagctccgagaactcggcggcggagagggat
ttagcggatgtcaagtcgtctctagtcaatgaatcagaaacgaatcagaacagctcctcc
gactccgaggcggaaagacggcctccgcctcgctccgaaagtttccgagataaatcccgg
gaaagtttggaagaagcggccaagaggcaagatggagggctctttaaggggccaccgtat
cccggctaccccttcatcatgatccccgacctgacgagcccctacctccccaacggatcg
ctctcgcccaccgcccgaaccctccattttcagtccggcagcacacattactctgcgtac
aaaacgattgaacaccagattgcaattcagtacctgcagatgaaatggcccttgctggat
gtccaggcagggggcctgcagagtagacaggctctcaaggacgcccgctcgccgtcgcca
gctcacattgtttcgaacaaagtgccggtggtgcagcaccctcaccatgtccaccccctc
acacctcttatcacctacagcaatgaacacttcacgcccggaaacccacctccacactta
ccagccgacgtagaccccaaaacaggaatcccccggcctccgcaccctccagatatatct
ccgtactacccgctatcgcccggcaccgtaggacagatcccccatccgctcggatggtta
gtaccacagcaaggtcaaccagtgtacccaatcacgacaggagggttcagacacccctac
cccacagctctgaccgtcaatgcttccatgtccaggttccctccccacatggttccacca
catcacactctgcacacgaccggcatcccccacccggccatagtcacacccacagtgaag
caggaatcctcccagagtgacgtcggctcactccacagctcaaagcatcaggactccaag
aaggaagaggagaagaagaagccccacataaagaaacctcttaacgcgttcatgttgtat
atgaaggagatgagagccaaggtcgtcgccgagtgcacactgaaagagagtgcggccatc
aaccagatcctggggcggaggtggcatgcgctgtccagagaggagcaagcaaaatattac
gagctggcccggaaggagcgacagcttcacatgcagctctaccctggctggtccgcgcgg
gataactacgggaagaagaagaagaggaaaagggacaagcaaccgggagagaccaatgat
gcaaatactccaaagaagtgtcgggcactgttcgggcttgacagacagactttatggtgc
aagccgtgcaggagaaaaaaaaagtgcgttcgctacatacaaggtgaaggcagctgcctc
agccccccctcttcagatggaagcctactagactcgcctcccccctccccgcacctgcta
ggctcccctcccccagacgccaagtcacagactgagcagacacagccgctctcgctgtcc
ctgaagcccgaccccctggcccacctggccatgatgcctccgccgcccgcgctcctgctg
gccgaggccgcccacggcaaggcctccgccctctgtcccaacggggctctggacctgcca
cctgccgccttgcagccgcccattgtcgcctcgtcctcgctcgcacagccgtcaacatct
tccttacattcccacagctcgttggccgggacccagccccagcctctctccctcgtcacc
aagtctttagagtaa

DBGET integrated database retrieval system