KEGG   Oryctolagus cuniculus (rabbit): 100339430
Entry
100339430         CDS       T03373                                 

Gene name
CHEK2
Definition
(RefSeq) checkpoint kinase 2
  KO
K06641  serine/threonine-protein kinase CHEK2 [EC:2.7.11.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04110  Cell cycle
ocu04115  p53 signaling pathway
ocu04218  Cellular senescence
ocu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100339430 (CHEK2)
   04115 p53 signaling pathway
    100339430 (CHEK2)
   04218 Cellular senescence
    100339430 (CHEK2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100339430 (CHEK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100339430 (CHEK2)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ocu03400]
    100339430 (CHEK2)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100339430 (CHEK2)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: CAMK group
  RAD53 family
   100339430 (CHEK2)
DNA repair and recombination proteins [BR:ocu03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100339430 (CHEK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr FHA Kinase-like Kdo Pkinase_fungal RIO1 YrbL-PhoP_reg Haspin_kinase APH
Other DBs
NCBI-GeneID: 100339430
NCBI-ProteinID: XP_017206175
LinkDB
Position
Un
AA seq 367 aa
MGPKNSYIAYIEDHSGNGTFVNTELVGKGKRRPLNNNSEIALSLCRNKVFVFFDLTVDDQ
SVYPKELRDEYIMSKTLGSGACGEVKLAFERKTCKKVAIKIISKRKFAIGSAREVDPALN
VETEIEILKKLNHPCIIKIKNFFDAEDYYIVLELMEGGELFEKVVGNKRLKEATCKLYFY
QMLLAVQYLHENGIIHRDLKPENVLLSSQDEDCLIKITDFGQSKILGETSLMRTLCGTPT
YLAPEVLLSIGTAGYNRAVDCWSLGVILFICLSGYPPFSEHKTQVSLKDQITSGKYNFIP
EVWADVSEKALDLVKKLLVVDPKVRLTTEEALNHPWLQPSTSQKRPLEEEAENAEATKRR
TVCAAVS
NT seq 1104 nt   +upstreamnt  +downstreamnt
atggggcctaaaaactcttacatcgcatacatagaagatcacagtgggaacggaaccttt
gtaaacacagagctcgtagggaaaggaaaacgccgtcctttgaataacaattcagaaatt
gcactttcactgtgtagaaataaagtttttgtattttttgacctgacagtagatgatcag
tcagtttatcctaaggaattaagagatgaatacatcatgtccaaaactcttggaagtggt
gcctgtggagaggtgaagcttgcttttgaaaggaaaacgtgtaagaaagtagccataaag
atcatcagcaaaaggaagtttgctattggctctgcaagagaggttgacccggctctcaat
gttgaaacagaaatagaaattttgaaaaagctgaatcatccttgcatcatcaagattaaa
aacttttttgatgcagaagattattatattgttttggaattaatggaaggaggagagctg
tttgagaaggtggtggggaacaagcgcctgaaagaagccacctgcaaactctacttttac
cagatgctcttggctgtgcagtatctgcacgaaaatggcattatacatcgcgacttaaag
ccagagaatgtactgctgtcatcccaagacgaggactgccttataaagattactgatttt
gggcagtccaagattttgggggagacctcgctcatgagaaccttgtgtggtacccccacc
tacttggctcctgaggttcttctgtccattgggacagccgggtataaccgcgctgtggac
tgctggagcctgggcgtcatcctttttatctgccttagtgggtatccacctttctctgag
cataagacgcaagtgtccctgaaggatcagatcaccagtggaaaatacaacttcattcct
gaagtctgggcagatgtttcagagaaggctctggacctcgtcaagaagttgttggtagtg
gacccaaaggtgcgtcttacaacagaagaagctttaaatcacccttggcttcagccttcc
actagtcaaaagcggccccttgaagaagaagcagagaatgctgaggccacaaagcgccgg
accgtgtgtgctgctgtgtcgtaa

DBGET integrated database retrieval system