KEGG   Oryctolagus cuniculus (rabbit): 100339544
Entry
100339544         CDS       T03373                                 

Gene name
FZD3
Definition
(RefSeq) frizzled class receptor 3
  KO
K02329  frizzled 3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04150  mTOR signaling pathway
ocu04310  Wnt signaling pathway
ocu04360  Axon guidance
ocu04390  Hippo signaling pathway
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04916  Melanogenesis
ocu04934  Cushing syndrome
ocu05010  Alzheimer disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05165  Human papillomavirus infection
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05206  MicroRNAs in cancer
ocu05217  Basal cell carcinoma
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100339544 (FZD3)
   04390 Hippo signaling pathway
    100339544 (FZD3)
   04150 mTOR signaling pathway
    100339544 (FZD3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100339544 (FZD3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100339544 (FZD3)
  09158 Development and regeneration
   04360 Axon guidance
    100339544 (FZD3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100339544 (FZD3)
   05206 MicroRNAs in cancer
    100339544 (FZD3)
   05205 Proteoglycans in cancer
    100339544 (FZD3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100339544 (FZD3)
   05226 Gastric cancer
    100339544 (FZD3)
   05217 Basal cell carcinoma
    100339544 (FZD3)
   05224 Breast cancer
    100339544 (FZD3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100339544 (FZD3)
   05022 Pathways of neurodegeneration - multiple diseases
    100339544 (FZD3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100339544 (FZD3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100339544 (FZD3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ocu04030]
    100339544 (FZD3)
G protein-coupled receptors [BR:ocu04030]
 Frizzled / Smoothened family
  100339544 (FZD3)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 100339544
NCBI-ProteinID: XP_017193334
Ensembl: ENSOCUG00000025264
LinkDB
Position
2
AA seq 666 aa
MAMSWILFSLWPLTMFVGPVNGHSLFSCEPITLRMCQDLPYNTTFMPNLLNHYDQQTAAL
AMEPFHPMVNLDCSRDFRPFLCALYAPICMEYGRVTLPCRRLCQRAYSECSKLMEMFGVP
WPEDMECSRFPDCDEPYPRLVDLNLVGDPTEGAPVAVQRDYGFWCPRELKIDPDLGYSFL
HVRDCSPPCPNMYFRREELSFARYFIGLISIICLSATLFTFLTFLIDVTRFRYPERPIIF
YAVCYMMVSLIFFIGFLLEDRVACNASSPAQYKASTVTQGSHNKACTMLFMVLYFFTMAG
SVWWVILTITWFLAAVPKWGSEAIEKKALLFHASAWGIPGTLTIILLAMNKIEGDNISGV
CFVGLYDVDALRYFVLAPLCLYVVVGVSLLLAGIISLNRVRIEIPLEKENQDKLVKFMIR
IGVFSILYLVPLLVVIGCYFYEQAYRGIWETTWIQERCREYHIPCPYQVTQMSRPDLILF
LMKYLMALIVGIPSIFWVGSKKTCFEWASFFHGRRKKEIVNESRQVLQEPDFAQSLLRDP
NTPIIRKSRGTSTQGTSTHASSTQLAMVDDQRSKAGSVHSKVSSYHGSLHRSRDGRYTPC
SYRGMEERLPHGSMSRLTDHSRHSSSHRLNEQSRHSSIRDLSNNPMTHITHGTSMNRVIE
EDGTSA
NT seq 2001 nt   +upstreamnt  +downstreamnt
atggcaatgagttggattctcttctctctttggcccttgaccatgtttgtggggcctgta
aatgggcacagtttgttttcttgtgaacctattaccttgaggatgtgccaagatttgcct
tataataccaccttcatgcctaatcttctgaatcattatgaccaacaaacggcagcttta
gcaatggagccattccatcctatggtgaatctggattgttctcgagatttccgaccattt
ctttgtgcactctatgctcctatttgtatggaatatggacgtgtcacacttccctgccga
agactgtgccagcgggcttacagtgaatgttcaaagctcatggagatgtttggtgttcct
tggcctgaagatatggaatgcagtaggttcccagattgtgatgagccgtatcctcgactt
gtggatctgaatttagttggagatccaactgaaggagccccagtggcagtgcagagggac
tatggtttttggtgtccccgagaattgaaaattgatcctgatcttggttattcatttttg
cacgtgcgtgattgttcacctccttgtccaaatatgtattttaggagagaagaactgtca
tttgctcgctatttcataggactgatttcaatcatttgcctttctgccacgttgtttact
tttttaacttttttgattgatgtcacaagattccgttatcctgaaaggcctattatattt
tatgcagtctgctatatgatggtatctttaattttcttcattgggtttttgcttgaagac
cgagtagcctgcaacgcatctagccctgcgcaatataaagcttctacagtgacacaagga
tctcataataaagcctgtaccatgctttttatggtactttattttttcaccatggctgga
agtgtatggtgggtaattcttaccatcacatggtttctagcagctgtgccaaagtggggt
agtgaagctattgagaagaaagcattgctatttcacgccagtgcatggggcatccctgga
actctaactatcatccttttagcgatgaataaaattgaaggtgacaacattagtggcgtg
tgttttgttggcctctacgatgttgacgcattgagatactttgttcttgctcccctctgc
ctatatgtggtagttggggtttcactcttgttagctggcattatatccctaaacagagtt
cgaattgagattccattagaaaaggagaaccaagataaattagtgaagtttatgatccgg
attggtgttttcagcattctttatctcgtaccactcttggttgtaattggatgctacttt
tacgaacaagcctaccgtggcatctgggaaacaacatggatacaagaacgctgcagagaa
tatcacattccatgcccatatcaggttactcaaatgagtcgtccagacctgattctcttt
ctgatgaaatacctgatggctctcatagttggtattccctccattttttgggttggaagc
aaaaagacatgttttgaatgggccagttttttccatggtcgtcggaaaaaagagatagtg
aatgagagccgacaggtcctccaggaacctgattttgctcagtcactcctgagggatcca
aatactcctataataaggaaatcaagaggaacttccactcaaggaacatccacacatgct
tcttcaactcagttggctatggtggatgatcagagaagcaaagcagggagtgtccacagc
aaagtgagcagctaccatggcagcctccacagatcacgtgatggcaggtacactccctgc
agttacagaggaatggaggagagactacctcatggcagcatgtcacgactaacggatcac
tccaggcacagcagttctcatcggctcaatgaacagtcacgacatagcagcatcagagac
ctcagtaacaatcccatgactcacatcacacatggcaccagcatgaatcgagtgattgaa
gaagatggaactagtgcttaa

KEGG   Oryctolagus cuniculus (rabbit): 100342099
Entry
100342099         CDS       T03373                                 

Gene name
FZD4
Definition
(RefSeq) frizzled class receptor 4
  KO
K02354  frizzled 4
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04150  mTOR signaling pathway
ocu04310  Wnt signaling pathway
ocu04390  Hippo signaling pathway
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04916  Melanogenesis
ocu04934  Cushing syndrome
ocu05010  Alzheimer disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05165  Human papillomavirus infection
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05217  Basal cell carcinoma
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100342099 (FZD4)
   04390 Hippo signaling pathway
    100342099 (FZD4)
   04150 mTOR signaling pathway
    100342099 (FZD4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100342099 (FZD4)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100342099 (FZD4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100342099 (FZD4)
   05205 Proteoglycans in cancer
    100342099 (FZD4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100342099 (FZD4)
   05226 Gastric cancer
    100342099 (FZD4)
   05217 Basal cell carcinoma
    100342099 (FZD4)
   05224 Breast cancer
    100342099 (FZD4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100342099 (FZD4)
   05022 Pathways of neurodegeneration - multiple diseases
    100342099 (FZD4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100342099 (FZD4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100342099 (FZD4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ocu04030]
    100342099 (FZD4)
   04090 CD molecules [BR:ocu04090]
    100342099 (FZD4)
G protein-coupled receptors [BR:ocu04030]
 Frizzled / Smoothened family
  100342099 (FZD4)
CD molecules [BR:ocu04090]
 Proteins
  100342099 (FZD4)
SSDB
Motif
Pfam: Frizzled Fz Chol_subst-bind
Other DBs
NCBI-GeneID: 100342099
NCBI-ProteinID: XP_002708694
UniProt: A0A5F9DBD7
LinkDB
Position
1
AA seq 537 aa
MAWRGAGPSAPGAPRGAGLRLGLLLQLLLLLGPARGFGDEEERRCDPIRISMCQNLGYNV
TKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGM
CLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPVQPGEE
CHSVGSNSDQYIWVKRSLNCVLKCGYDAGLYSRSAKEFTDIWMAVWASLCFISTAFTVLT
FLIDSSRFSYPERPIIFLSMCYNIYSIAYIVRLTVGRERISCDFEEAAEPVLIQEGLKNT
GCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAVKTI
VILIMRLVDADELTGLCYVGNQNLDALTGFVVAPLFTYLVIGTLFIAAGLVALFKIRSNL
QKDGTKTDKLERLMVKIGVFSVLYTVPATCVIACYFYEISNWALFRYSADDSNMAVEMLK
IFMSLLVGITSGMWIWSAKTLHTWQRCSNRLVNSGKVKREKRGNGWVKPGKGNETVV
NT seq 1614 nt   +upstreamnt  +downstreamnt
atggcctggcggggcgcagggccgagcgccccgggggcgcccaggggcgccggactccgt
ctagggctgctgctgcagttgctcctgctcctggggccggcgcggggtttcggagacgag
gaggaacggcgctgcgaccccatccgcatttccatgtgccagaaccttggctacaacgtg
accaagatgcccaacctggtggggcacgagctgcagacggacgccgaactgcagctgaca
actttcacgccgctcatccagtacggctgttccagccagctgcagttcttcctttgttcg
gtttatgtgccaatgtgcacagagaagatcaacatccccatcggcccgtgcggcggcatg
tgtctttcagtcaagagacgctgtgagcccgtcctgaaggaatttggatttgcctggccg
gagagcctgaactgcagtaaattcccaccacagaacgaccacaaccacatgtgcatggaa
gggccaggtgatgaagaggtgcccttaccacacaaaacccccgtgcagcctggggaagag
tgtcactccgtgggaagcaattcagatcagtacatctgggtgaaaaggagcctgaactgc
gtcctcaagtgtggctatgacgccggcttgtacagccgctcggccaaggagttcaccgac
atctggatggccgtgtgggccagcctgtgcttcatctccactgccttcacggtgctgacc
ttcctcatcgactcgtccaggttttcctaccctgagcgccccatcatatttctcagtatg
tgctataatatttatagcattgcttatattgtcaggctgactgtaggccgggaaaggata
tcctgcgattttgaagaggcagcagaacccgttctcatccaagaaggacttaagaacaca
ggatgtgcaataattttcttgctgatgtacttttttggaatggccagctccatctggtgg
gttattctgacactcacttggtttttggcagctggactcaaatggggtcatgaagccatt
gaaatgcacagctcttatttccatattgcagcctgggctattcctgcagtgaaaaccatt
gtcatcttgattatgagactggtggatgcggatgagctgacgggcctgtgctatgttggg
aaccaaaacctcgatgccctcactggcttcgtggtggctcccctcttcacttacttggtg
atcgggaccttgttcattgcagcaggtttggtggctttgttcaagattcggtcaaatctt
caaaaggatgggacaaagacagacaagttagaaaggctgatggtcaagattggggtcttc
tcagtactgtatacggttcctgcaacctgtgtaattgcctgttatttctatgaaatttct
aactgggcgctcttccggtattctgcagatgattccaatatggcggtagagatgttgaaa
atttttatgtctttgctggtgggcatcacttcgggcatgtggatttggtctgccaaaact
cttcacacgtggcagaggtgctccaacagattggtgaattctgggaaggtaaagagagag
aagagagggaatggttgggtgaaacctgggaaaggcaatgaaactgtggtttaa

KEGG   Oryctolagus cuniculus (rabbit): 100344394
Entry
100344394         CDS       T03373                                 

Gene name
FZD6
Definition
(RefSeq) frizzled class receptor 6
  KO
K02376  frizzled 6
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04150  mTOR signaling pathway
ocu04310  Wnt signaling pathway
ocu04390  Hippo signaling pathway
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04916  Melanogenesis
ocu04934  Cushing syndrome
ocu05010  Alzheimer disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05165  Human papillomavirus infection
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05217  Basal cell carcinoma
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100344394 (FZD6)
   04390 Hippo signaling pathway
    100344394 (FZD6)
   04150 mTOR signaling pathway
    100344394 (FZD6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100344394 (FZD6)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100344394 (FZD6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100344394 (FZD6)
   05205 Proteoglycans in cancer
    100344394 (FZD6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100344394 (FZD6)
   05226 Gastric cancer
    100344394 (FZD6)
   05217 Basal cell carcinoma
    100344394 (FZD6)
   05224 Breast cancer
    100344394 (FZD6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100344394 (FZD6)
   05022 Pathways of neurodegeneration - multiple diseases
    100344394 (FZD6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100344394 (FZD6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100344394 (FZD6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ocu04030]
    100344394 (FZD6)
G protein-coupled receptors [BR:ocu04030]
 Frizzled / Smoothened family
  100344394 (FZD6)
SSDB
Motif
Pfam: Frizzled Fz Folate_rec Integrin_alpha RseC_MucC
Other DBs
NCBI-GeneID: 100344394
NCBI-ProteinID: XP_002710771
Ensembl: ENSOCUG00000009180
UniProt: G1SWP7
LinkDB
Position
3
AA seq 712 aa
MDMFAFLLTCMFLPLIRGHSLFTCEPITVPRCMKMAYNMTFFPNLMGHYDQGIAAVEMEH
FLPLANLECSPNVETFLCKAFIPTCTEQIHVIPPCRKFCEKVYSDCRKLIDTFGIRWPEE
LECNRLQYCDETAPVTFDPHTEFLGPQKKTEQVQRDIGFWCPRHLKTSGGQGYKFLGIDQ
CAPPCPNMYFKSDELEFAKSFIGIVSIFCLCATLFTFLTFLIDVKRFRYPERPIIYYSVC
YSIVSLIYFIGFLLGNNTACNKADEKLELGDTVVLGSQNKACTVLFMFLYFFTMAGTVWW
VILTITWFLAAGRKWSCEAIEQKAVWFHAVAWGIPGFLTVMLLAMNKVEGDNISGVCFVG
LYDLDASRYFVLLPLCLCVFVGLSLLLAGIISLNHVRQVIQHDGRNQEKLKKFMIRIGVF
SGLYLVPLVTLLGCYVYEQVNRITWEITWVSDHCRQYHIPCPYQAKTKARPELALFMIKY
LMTLIVGISPVFWVGSKKTCTEWAGFFKRNRKRDPISESRRVLQESCEFFLKHNSKVKHK
KKHYKPSSHKLKVISKSMGTSTGATANHGTSAVAITDHDFLGQETLTEIQTSPEASVREV
RADGASTPKVREQDCGEPASPTAASAKVSGEQADKKSRAGSVKAKNSVSEGVRSEGRVSP
KSDDTDTGPVQSNNVQLASSSEPGSLKGSTSLLVHSVPGVRKEQGAGSHSDT
NT seq 2139 nt   +upstreamnt  +downstreamnt
atggacatgtttgcatttctgttgacatgtatgtttctacccctcataagggggcacagt
ctcttcacctgtgaaccaattactgttcccagatgtatgaaaatggcctacaacatgaca
tttttccctaatctgatgggtcattatgaccaaggtattgctgctgtggaaatggagcat
tttcttcctcttgcaaatctggaatgttcaccaaatgttgaaactttcctttgcaaagcc
tttataccaacctgtacagagcaaattcatgtgattccaccttgtcgtaagttttgtgag
aaagtatattcagattgcagaaaactgattgacacctttgggatccgatggccagaggaa
ctcgagtgtaacagattacaatactgcgatgagactgctcctgtaactttcgatccacac
acagagtttcttggtcctcagaagaaaacagagcaagttcaaagagacattgggttttgg
tgtccaaggcatcttaagacttctgggggacaaggatacaagtttctgggaattgaccaa
tgtgcacctccatgccccaacatgtattttaaaagcgatgagctggagtttgccaaaagt
tttattggaatagtttcaatattttgtctttgtgcaactctgttcacattccttactttt
ttaattgatgtcaagagattcagatacccagagagaccaattatatattattctgtctgt
tacagcattgtatctcttatatactttattggatttctgctaggcaataacacagcctgt
aacaaggcggatgagaagctggaacttggcgacacagttgtcctaggttctcaaaataag
gcttgcaccgttttgtttatgtttctgtattttttcacaatggctggcaccgtgtggtgg
gtgattctgaccattacttggttcttagcagcaggacgaaaatggagttgtgaagccatt
gaacaaaaagcagtgtggtttcatgctgttgcctggggaataccaggttttctgactgtt
atgcttcttgcaatgaacaaggttgaaggagacaacattagtggggtttgctttgttggc
ctgtatgatctggatgcttctcgctactttgtactcttgccactgtgcctttgtgtgttt
gttgggctgtctcttcttttagctggtattatttccttaaatcatgtgcgacaggttata
caacatgatggccggaaccaagagaaactaaagaaatttatgattcgaattggggtcttc
agtggcctgtatcttgtgccattagtgacactccttggatgttatgtgtatgagcaagtg
aacaggatcacctgggagataacgtgggtgtccgatcactgtcgtcagtaccatattcct
tgtccctatcaggcaaaaacaaaagctcgaccagaattggctttgtttatgataaaatac
ctgatgacattaattgttggcatctctcccgtcttctgggttggaagcaaaaagacatgc
acagaatgggctgggttttttaaaagaaatcgcaagagagatccaatcagtgaaagtcga
agagtactacaggagtcatgtgagtttttcttgaagcacaattctaaagttaagcacaaa
aagaagcactataaaccaagttcacataagctgaaggtcatttccaagtccatgggaacc
agcacaggcgctacagcaaatcatggcacgtctgcggtagcaatcactgatcatgatttc
ttaggacaggaaaccttgacagaaatccaaacctccccagaagcatcagtgagagaggtg
agagcggatggcgcaagcacccccaaagtaagagaacaagactgtggtgagcctgcctcc
ccaacagcagccagtgccaaggtctctggggaacaggcggacaagaaaagccgagcaggc
agtgtgaaggctaagaacagtgtgtctgagggtgtgcggagcgagggaagggtaagtcca
aagagtgatgacactgacactggcccagtgcagagcaacaatgtgcagctcgccagttct
tcagagccgggcagcctcaaaggttccacctctctgcttgttcactcggttccaggagtc
agaaaagagcagggagctggcagtcactcagatacctga

KEGG   Oryctolagus cuniculus (rabbit): 100345803
Entry
100345803         CDS       T03373                                 

Gene name
FZD9
Definition
(RefSeq) frizzled class receptor 9
  KO
K02842  frizzled 9/10
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04150  mTOR signaling pathway
ocu04310  Wnt signaling pathway
ocu04390  Hippo signaling pathway
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04916  Melanogenesis
ocu04934  Cushing syndrome
ocu05010  Alzheimer disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05165  Human papillomavirus infection
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05217  Basal cell carcinoma
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100345803 (FZD9)
   04390 Hippo signaling pathway
    100345803 (FZD9)
   04150 mTOR signaling pathway
    100345803 (FZD9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100345803 (FZD9)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100345803 (FZD9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100345803 (FZD9)
   05205 Proteoglycans in cancer
    100345803 (FZD9)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100345803 (FZD9)
   05226 Gastric cancer
    100345803 (FZD9)
   05217 Basal cell carcinoma
    100345803 (FZD9)
   05224 Breast cancer
    100345803 (FZD9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100345803 (FZD9)
   05022 Pathways of neurodegeneration - multiple diseases
    100345803 (FZD9)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100345803 (FZD9)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100345803 (FZD9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ocu04030]
    100345803 (FZD9)
   04090 CD molecules [BR:ocu04090]
    100345803 (FZD9)
G protein-coupled receptors [BR:ocu04030]
 Frizzled / Smoothened family
  100345803 (FZD9)
CD molecules [BR:ocu04090]
 Proteins
  100345803 (FZD9)
SSDB
Motif
Pfam: Frizzled Fz 7tm_2 Dicty_CAR
Other DBs
NCBI-GeneID: 100345803
NCBI-ProteinID: XP_008247319
LinkDB
Position
Un
AA seq 585 aa
MRRPGPRLWLLLQVVGSCAAIGSLDRERPGDGQCQPIEIPMCKDIGYNSTRMPNLMGHED
QREAAIQLHEFAPLVEYGCHGDLRFFLCSLYAPMCTDQVSTPIPACRPMCEQARLRCAPI
MEQFNFGWPDSLDCARLPTRNDPHALCMEAPENATAGPAEPHKGLGMLPVAPRPARPPGE
AGAGAGAGACANPEKFQYVERSRSCAPRCGPGVEVFWSRRDKDFALVWMAVWSALCFCST
AFTVLTFLLEPHRFQYPERPIIFLSMCYNVYSLAFLIRAVAGAQSVACDQEAGALYVIQE
GLESTGCTLVFLLLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEAHGSYFHLAAWGLP
ALKTIVILTLRKVAGDELTGLCYVASMDAAALTGFVLVPLSCYLVLGTSFLLTGFVALFH
IRKIMKTGGTNTEKLEKLMVKIGVFSILYTVPATCVIVCYVYERLNMDYWRLRATEQPCA
AAALPGGRRDCSLPGGSVPTVAVFMLKIFMSLVVGITSGVWVWSSKTLQTWQSLCHRKLA
AGRARAKACRAPGGYGRGTHCHYKAPTVVLHMTKTDPCLENPTHL
NT seq 1758 nt   +upstreamnt  +downstreamnt
atgcggcgcccgggcccgcgcctgtggctgctgctgcaggtggtgggctcgtgcgccgcc
atcggctccctggaccgcgagcgcccgggcgacggccagtgccagcccatcgagatcccc
atgtgcaaggacatcggctacaactcgacgcgcatgcccaacctgatgggccacgaggac
cagcgcgaggccgccatccagctgcacgagttcgcgccgctcgtggagtacggctgccac
ggagacctgcgcttcttcctgtgctcgctgtacgcgcccatgtgcaccgaccaggtctcg
acgcccatccccgcctgccggcccatgtgcgagcaggcccgcctgcgctgcgcgcccatc
atggagcagttcaacttcggctggcccgactcgctcgactgcgcgcggctgcccacgcgc
aacgacccgcacgcgctgtgcatggaggcgcccgagaacgccacggccggccccgccgag
ccgcacaagggcctgggcatgctgcctgtggcgccgcggcccgccaggccccccggcgag
gcgggcgccggcgccggcgccggcgcctgcgccaaccccgagaagttccagtacgtggag
aggagccgctcgtgcgcgccgcgctgcgggccgggcgtcgaggtgttctggtcgcggcgc
gacaaggacttcgcgctcgtctggatggcagtgtggtcggcgctctgcttctgctccacc
gccttcaccgtgctcaccttcctgctggagccgcaccgcttccagtacccggagcgcccc
atcatcttcctctccatgtgctacaacgtctactcgctggccttcctcatccgcgccgtg
gcgggcgcgcagagcgtggcctgcgaccaggaggcgggcgcgctctacgtgatccaggaa
gggctggagagcaccggctgcaccctggtcttcctgctgctctactacttcggcatggcc
agctcgctctggtgggtggtcctcacgctcacctggttcctggcggccggcaagaagtgg
ggccacgaagccatcgaggcgcacggcagctacttccacctggctgcctggggcctgcca
gcactcaagaccatcgtcatcctgacactgcgcaaggtggccggggatgaactgaccggg
ctctgctacgtggccagcatggacgccgcggcgctcacgggcttcgtcttggtgcccctc
tcctgctacctggtgctgggcaccagcttcctcctgaccggcttcgtggccctcttccat
atccgcaagatcatgaagacaggcggcaccaatacggagaagctggagaagctcatggtc
aagatcggggtcttctccatcctctacacggtgccagccacctgcgtcatcgtgtgctat
gtctatgagcgcctcaacatggactactggcgcctgcgtgccacggagcagccgtgcgcc
gccgccgccctgcccggcggccgcagggactgctccctgcccgggggctcggtgcccacc
gtggccgtcttcatgctcaagatcttcatgtcgctggtggtgggcatcaccagcggggtc
tgggtgtggagctccaagactttgcagacttggcagagcctgtgccaccggaagttggca
gctggccgggcccgggccaaggcctgccgggcgcccgggggctacggccgtggcacccac
tgccactacaaggcccccaccgtggtcctgcacatgaccaagacggacccttgtctggag
aaccccacccacctctag

KEGG   Oryctolagus cuniculus (rabbit): 100350521
Entry
100350521         CDS       T03373                                 

Gene name
FZD2
Definition
(RefSeq) frizzled class receptor 2
  KO
K02235  frizzled 2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04150  mTOR signaling pathway
ocu04310  Wnt signaling pathway
ocu04390  Hippo signaling pathway
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04916  Melanogenesis
ocu04934  Cushing syndrome
ocu05010  Alzheimer disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05165  Human papillomavirus infection
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05217  Basal cell carcinoma
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100350521 (FZD2)
   04390 Hippo signaling pathway
    100350521 (FZD2)
   04150 mTOR signaling pathway
    100350521 (FZD2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100350521 (FZD2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100350521 (FZD2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100350521 (FZD2)
   05205 Proteoglycans in cancer
    100350521 (FZD2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100350521 (FZD2)
   05226 Gastric cancer
    100350521 (FZD2)
   05217 Basal cell carcinoma
    100350521 (FZD2)
   05224 Breast cancer
    100350521 (FZD2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100350521 (FZD2)
   05022 Pathways of neurodegeneration - multiple diseases
    100350521 (FZD2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100350521 (FZD2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100350521 (FZD2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ocu04030]
    100350521 (FZD2)
G protein-coupled receptors [BR:ocu04030]
 Frizzled / Smoothened family
  100350521 (FZD2)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 100350521
NCBI-ProteinID: XP_002719231
LinkDB
Position
19
AA seq 559 aa
MSEEEGSPSKKGAKSVLPLEPQILTRALNHGFCQPISIPLCTDIAYNQTIMPNLLGHTNQ
EDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLEQAIPPCRSICERARQGCEALMN
KFGFQWPERLRCEHFPRHGAEQICVGQNHSEDGAPALLTTAPPPGLQPGAGGTPGGPGGG
GAPPRYATLEHPFHCPRVLKVPSYLSYKFLGERDCAAPCEPARPDGSMFFSQEETRFARL
WILTWSVLCCASTFFTVTTYLVDMQRFRYPERPIIFLSGCYTMVSVAYIAGFVLQERVVC
NERFSEDGYRTVVQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKWGHEAIE
ANSQYFHLAAWAVPAVKTITILAMGQIDGDLLSGVCFVGLNSLDPLRGFVLAPLFVYLFI
GTSFLLAGFVSLFRIRTIMKHDGTKTEKLERLMVRIGVFSVLYTVPATIVIACYFYEQAF
REHWERSWVSQHCKSLAIPCPAHYTPRTSPDFTVYMIKYLMTLIVGITSGFWIWSGKTLH
SWRKFYARLASGRHGETTV
NT seq 1680 nt   +upstreamnt  +downstreamnt
atgtctgaagaggaaggcagccccagcaagaagggggccaagagcgttctcccgctggaa
ccgcagattctgacccgagccttgaaccacggcttctgccagcccatctccatcccgctg
tgcacggacatcgcctacaaccagaccatcatgcccaacctgctgggccacacgaaccag
gaggacgcgggtctggaggtgcaccagttctacccgctggtgaaggtgcagtgctcgccc
gagctgcgcttcttcctgtgctccatgtacgcgcccgtgtgcaccgtgctggagcaggcc
atcccgccgtgccgctccatctgcgagcgcgcgcgccagggctgcgaagcgctcatgaac
aaattcgggttccagtggcccgagcgcctgcgctgcgagcacttcccgcgccacggcgcc
gagcagatctgcgtgggccagaaccactcggaggacggggcgcccgcgctgctcaccacc
gcgccgccgccaggactgcagccgggcgccgggggcaccccgggcggcccgggcggcggc
ggcgcgcccccgcgctacgccacgctggagcacccgttccactgcccgcgcgtcctcaag
gtgccgtcctacctcagctacaagtttctgggtgagcgcgattgcgcggcgccgtgcgag
ccggcgcggcccgacggctccatgttcttctcgcaggaggagacgcggttcgcgcgcctc
tggatcctcacctggtcggtgctgtgctgcgcctccaccttcttcacggtcaccacgtac
ctggtggacatgcagcgcttccgctacccggagcggcccatcatcttcctgtcgggctgc
tacaccatggtgtcggtggcctacatcgcgggcttcgtgctccaggagcgcgtggtgtgc
aacgagcgcttctccgaggacggctaccgcaccgtggtgcagggcaccaagaaggagggc
tgcaccatcctcttcatgatgctctacttcttcagcatggccagctccatctggtgggtc
atcctgtcgctcacctggttcctggcggccggcatgaagtggggccacgaggccatcgag
gccaactcgcagtacttccacctggccgcctgggccgtgccggccgtcaagaccatcacc
atcctggccatgggccagatcgacggcgacctgctcagcggcgtgtgcttcgtgggcctc
aacagcctggacccgctgcgcggcttcgtgctggcgccgctcttcgtctacctgttcatc
ggcacctccttcctgctggccggcttcgtgtcgctcttccgcatccgcaccatcatgaag
cacgacggcaccaagacggagaagctggagcggctcatggtgcgcatcggcgtgttctcg
gtgctctacaccgtgcccgccaccatcgtcatcgcctgctacttctacgagcaggccttc
cgcgagcactgggagcgctcctgggtgagccagcactgcaagagcctggccatcccgtgc
ccggcgcactacacgccgcgcacctcgcccgacttcaccgtctacatgatcaagtacctc
atgacgctcatcgtgggcatcacgtccggcttctggatctggtccggcaagacgctgcac
tcctggaggaagttctacgcgcggctggccagcggccggcacggggagaccaccgtgtga

KEGG   Oryctolagus cuniculus (rabbit): 100352919
Entry
100352919         CDS       T03373                                 

Gene name
FZD5
Definition
(RefSeq) frizzled class receptor 5
  KO
K02375  frizzled 5/8
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04150  mTOR signaling pathway
ocu04310  Wnt signaling pathway
ocu04390  Hippo signaling pathway
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04916  Melanogenesis
ocu04934  Cushing syndrome
ocu05010  Alzheimer disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05165  Human papillomavirus infection
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05217  Basal cell carcinoma
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100352919 (FZD5)
   04390 Hippo signaling pathway
    100352919 (FZD5)
   04150 mTOR signaling pathway
    100352919 (FZD5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100352919 (FZD5)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100352919 (FZD5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100352919 (FZD5)
   05205 Proteoglycans in cancer
    100352919 (FZD5)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100352919 (FZD5)
   05226 Gastric cancer
    100352919 (FZD5)
   05217 Basal cell carcinoma
    100352919 (FZD5)
   05224 Breast cancer
    100352919 (FZD5)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100352919 (FZD5)
   05022 Pathways of neurodegeneration - multiple diseases
    100352919 (FZD5)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100352919 (FZD5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100352919 (FZD5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ocu04030]
    100352919 (FZD5)
G protein-coupled receptors [BR:ocu04030]
 Frizzled / Smoothened family
  100352919 (FZD5)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 100352919
NCBI-ProteinID: XP_002712651
Ensembl: ENSOCUG00000027916
UniProt: G1TKZ4
LinkDB
Position
7
AA seq 587 aa
MARPDPSAPPSLLLLLLAQLAGRAAAASKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQ
DEAGLEVHQFWPLVEIHCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLM
RQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPRRFPAKPTPAGPAGAPAAGA
ECAAGGPSVCKCREPFVPILKESHPLYNKVRTGQVPNCAVPCYQPSFSPDERTFATFWIG
LWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCVSLGFLVRLVVGHASVACSR
EHSHIHYETTGPALCTVVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYAQYF
HLAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNSLRGFVLGPLVLYLLVGTLFLL
AGFVSLFRIRSVIKQGGTKTDKLEKLMIRIGIFTLLYTVPASIVVACYLYEQHYRESWEA
ALTCACPGPDAGQPRAKPEYWVLMLKYFMCLVVGITSGVWIWSGKTLESWRRFTSRCCCR
PRRGHKSGGAVAAAGDYAEASAALTGRTGPPGPAAAAYHKQVSLSHV
NT seq 1764 nt   +upstreamnt  +downstreamnt
atggctcggcctgacccgtccgcgccgccctcgctgctgctgctgctcctggcgcagctg
gcgggccgggcggcggccgcctccaaggccccggtgtgccaggaaatcacggtgcccatg
tgccgcggcatcggctataacctgacgcacatgcccaaccagttcaaccacgacacgcag
gacgaggcgggcctggaggtgcaccagttctggccgctggtggagatccactgctcgccg
gacctgcgcttcttcctgtgctccatgtacacgcccatctgcctgccggactaccacaag
ccgctgccgccctgccgctcggtgtgcgagcgcgccaaggccggctgctcgccgctcatg
cgccagtacggcttcgcctggcccgagcgcatgagctgcgaccgcctgcccgtgctgggc
cgcgacgccgaggtcctgtgcatggattacaaccgcagcgaagccaccacggcgcccccg
aggcgcttcccggccaagcccacgcccgcaggccccgcaggggcgccagccgccggggcc
gagtgcgcggcgggcggcccgtcggtgtgcaagtgccgcgagcccttcgtgcccatcctg
aaggagtcgcacccgctctacaacaaggtgcgcacgggccaggtgcccaactgcgcggtg
ccctgctaccagccgtctttcagcccggacgagcgcacgttcgccaccttctggatcggc
ctgtggtccgtgctgtgcttcatctccacctccaccaccgtggccaccttcctcatcgac
atggagcgcttccgctaccccgagcgccccatcatcttcttgtcggcctgctatctgtgc
gtgtcgctcggcttcctggtgcgcctggtcgtgggccacgccagtgtggcctgcagccgc
gagcacagccacattcactacgagaccacgggtcccgccctgtgcaccgttgtcttcctg
ctggtctacttcttcggcatggccagctccatctggtgggtcatcctatcgctcacctgg
ttcctggcggccggcatgaagtggggcaacgaggccatcgcgggctatgcgcagtacttc
cacctggccgcgtggctcatccccagcgtcaagtccatcacagcgctggcactgagctcc
gtggacggggaccccgtggctggcatctgctacgtgggcaaccagaacctgaactcgctg
cggggcttcgtgctgggcccgctggtgctctacctgctggtgggcaccctcttcctcctg
gcgggcttcgtgtcgctcttccgcatccggagcgtcatcaagcagggcggcaccaagacg
gacaagctggagaagctgatgatccgcatcggcatcttcacgctgctctacacggtgccc
gccagcatcgtggtggcctgctacctgtacgagcagcactaccgcgagagctgggaggcg
gcgctcacctgcgcgtgcccgggccccgacgccggccagccgcgcgccaagcccgagtac
tgggtgctcatgctcaagtacttcatgtgcctcgtggtgggcatcacgtcgggcgtctgg
atctggtccggcaagacgctggagtcgtggcggcgcttcaccagccgctgctgctgccgc
ccacggcgcggccacaagagcggcggggccgtggccgccgccggggactacgccgaggcc
agcgccgcgctcaccggcaggaccgggccgccgggccccgccgccgccgcctaccacaag
caggtgtccctgtcgcacgtgtag

KEGG   Oryctolagus cuniculus (rabbit): 100355594
Entry
100355594         CDS       T03373                                 

Gene name
FZD10
Definition
(RefSeq) frizzled-10
  KO
K02842  frizzled 9/10
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04150  mTOR signaling pathway
ocu04310  Wnt signaling pathway
ocu04390  Hippo signaling pathway
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04916  Melanogenesis
ocu04934  Cushing syndrome
ocu05010  Alzheimer disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05165  Human papillomavirus infection
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05217  Basal cell carcinoma
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100355594 (FZD10)
   04390 Hippo signaling pathway
    100355594 (FZD10)
   04150 mTOR signaling pathway
    100355594 (FZD10)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100355594 (FZD10)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100355594 (FZD10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100355594 (FZD10)
   05205 Proteoglycans in cancer
    100355594 (FZD10)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100355594 (FZD10)
   05226 Gastric cancer
    100355594 (FZD10)
   05217 Basal cell carcinoma
    100355594 (FZD10)
   05224 Breast cancer
    100355594 (FZD10)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100355594 (FZD10)
   05022 Pathways of neurodegeneration - multiple diseases
    100355594 (FZD10)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100355594 (FZD10)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100355594 (FZD10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ocu04030]
    100355594 (FZD10)
   04090 CD molecules [BR:ocu04090]
    100355594 (FZD10)
G protein-coupled receptors [BR:ocu04030]
 Frizzled / Smoothened family
  100355594 (FZD10)
CD molecules [BR:ocu04090]
 Proteins
  100355594 (FZD10)
SSDB
Motif
Pfam: Frizzled
Other DBs
NCBI-GeneID: 100355594
NCBI-ProteinID: XP_008250787
LinkDB
Position
Un
AA seq 374 aa
MYILEGGMSWSKADNRVTVIXLAEXSQLCFLSSAFTVLTFLIDPARFRYPERPIIFLSMC
YCVYSVGYIIRLFAGAESIACDRDSGQRYVIQEGLESTGCTLVFLVLYYFGMASSLWWVV
LTLTWFLAAGKKWGHEAIEANSSYFHLAAWAIPAVKTIVVLVMRRVAGDELTGVCYVGSM
DVNALTGFVLVPLACYLVVGTSFVLSGFVALFHIRRVMKTGGENTDKLEKLMVRIGVFSV
LYTVPATCVIACYFYERLNVDYWKTLATQHKCRVNNQTKDLDCAMAASIPAVEIFLVKVS
MLLVVGITSGMWVWTSKTLQSWQSVCSRRLRRSSRRKPASVIAGAGGGIYSKAQPPPKTH
QGKYEIPAPPPTCV
NT seq 1125 nt   +upstreamnt  +downstreamnt
atgtacatcctggaagggggcatgagctggagcaaggccgacaatcgcgtcaccgtgatc
tgactggcggagtgatcccagctgtgcttcctgtccagcgccttcaccgtgctcaccttc
ctcatcgacccggcgcgcttccggtaccccgagcgccccatcatcttcctctccatgtgc
tactgcgtctactccgtgggctacatcatccgcctcttcgcgggcgccgagagcatcgcg
tgcgaccgggacagcggccagcgctacgtgatccaggaggggctggagagcacgggctgc
accctggtcttcctggtgctctactacttcggcatggccagctcgctctggtgggtggtc
ctcacgctcacctggttcctggccgcgggcaagaagtggggccacgaggccatcgaggcc
aacagcagctacttccacctggccgcctgggccatcccggccgtgaagaccatcgtggtg
ctggtgatgcgccgggtggcgggcgacgagctgaccggcgtgtgctacgtgggcagcatg
gacgtgaacgccctcacgggcttcgtgctggtgccgctggcctgctacctggtggtgggc
acgtccttcgtgctgtccggcttcgtggccctcttccacatccgccgggtcatgaagacg
ggcggggagaacacggacaagctggagaagctcatggtgcggatcggcgtcttctccgtg
ctctacaccgtgcccgccacctgcgtcatcgcctgctacttctacgagcgcctgaacgtg
gactactggaagaccctggccacgcagcacaagtgcagggtgaacaaccagaccaaggac
ctggactgcgccatggcggcctccatcccggccgtggagatcttcctggtgaaggtgtcc
atgctgctggtcgtgggcatcaccagcggcatgtgggtctggacctccaagaccctgcag
tcctggcagagcgtgtgcagccgccggctgaggcggagcagccgcaggaagcccgccagc
gtcatcgccggcgccggcgggggcatttactccaaggcccagcctccccccaaaacccac
cagggcaagtacgagatccccgccccgccgcccacctgcgtgtga

KEGG   Oryctolagus cuniculus (rabbit): 100356368
Entry
100356368         CDS       T03373                                 

Gene name
FZD1
Definition
(RefSeq) frizzled class receptor 1
  KO
K02432  frizzled 1/7
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04150  mTOR signaling pathway
ocu04310  Wnt signaling pathway
ocu04390  Hippo signaling pathway
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04916  Melanogenesis
ocu04934  Cushing syndrome
ocu05010  Alzheimer disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05165  Human papillomavirus infection
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05217  Basal cell carcinoma
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100356368 (FZD1)
   04390 Hippo signaling pathway
    100356368 (FZD1)
   04150 mTOR signaling pathway
    100356368 (FZD1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100356368 (FZD1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100356368 (FZD1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100356368 (FZD1)
   05205 Proteoglycans in cancer
    100356368 (FZD1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100356368 (FZD1)
   05226 Gastric cancer
    100356368 (FZD1)
   05217 Basal cell carcinoma
    100356368 (FZD1)
   05224 Breast cancer
    100356368 (FZD1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100356368 (FZD1)
   05022 Pathways of neurodegeneration - multiple diseases
    100356368 (FZD1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100356368 (FZD1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100356368 (FZD1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ocu04030]
    100356368 (FZD1)
G protein-coupled receptors [BR:ocu04030]
 Frizzled / Smoothened family
  100356368 (FZD1)
SSDB
Motif
Pfam: Frizzled Fz 7tm_2 Dicty_CAR
Other DBs
NCBI-GeneID: 100356368
NCBI-ProteinID: XP_008259976
LinkDB
Position
10
AA seq 596 aa
LLLLLWLLEAPLLLGVRAQAAGQGPGPGQQPPPPPPPPPPPQQQQGGAQQYNGERGISIP
DHGYCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCS
MYAPVCTVLEQALPPCRSLCERARQGCEALMNKFGFQWPETLKCEKFPVHGAGELCVGQN
TSDKGTPTPSLLPEFWTSNPQHGGAGHRGGSAGGAGAAERGKFSCPRALKVPAYLNYHFL
GEKDCGAPCEPTKVYGLMYFEPEELRFXRTWVGIWSVLCCASTLFTVLTYLVDMRRFSYP
ERPIIFLSGCYTAVAVAYIAGFLLEDRVVCNDKFAEDGARTVAQGTKKEGCTILFMMLYF
FSMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAIKTITILALGQVDGD
VLSGVCFVGLNNVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLE
KLMVRIGVFSVLYTVPATIVIACYFYEQAFRDQWERSWVAQSCKSYAIPCPHLQAGGAAP
PHPPMSPDFTVFMIKYLMTLIVGITSGFWIWSGKTLNSWRKFYTRLHNSKQEETTI
NT seq 1791 nt   +upstreamnt  +downstreamnt
ctgctgctgctgctctggctgctggaggccccgctgctgctgggggtccgcgcgcaggcg
gcgggccaggggcccgggccggggcagcagcccccgccgccgccgcctccgccgccgccg
ccccagcagcagcagggcggcgcgcagcagtacaacggcgagcggggcatctccatcccg
gaccacggctactgccagcccatctccatcccgctgtgcacggacatcgcgtacaaccag
accatcatgcccaacctgctgggccacacgaaccaggaggacgcgggcctcgaggtgcac
cagttctacccgctggtgaaggtgcagtgctcggccgagctcaagttcttcctgtgctcc
atgtacgcgcccgtgtgcaccgtgctggagcaggcgctgccgccctgccgctccctgtgc
gagcgcgcgcgccagggctgcgaggcgctcatgaacaagttcggcttccagtggcccgag
acgctcaagtgcgagaagttcccggtgcacggcgcgggcgagctgtgcgtgggccagaac
acgtccgacaagggcacgccgacgccgtcgctgctgcccgagttctggaccagcaacccg
cagcacggcggcgcgggccaccgcggcggctccgccgggggcgcgggcgcggcggagcgc
ggcaagttctcctgcccgcgcgcgctcaaggtgcccgcctacctcaactaccacttcctg
ggcgagaaggactgcggcgcgccctgcgagcccaccaaggtgtacgggctcatgtacttc
gagcccgaggagctgcgcttcnntcgcacctgggtcggcatctggtcggtgctgtgctgc
gcctccacgctcttcacggtgctcacgtacctggtggacatgcggcgcttcagctacccg
gagcggcccatcatcttcctgtcgggctgctacacggccgtggccgtggcctacatcgcc
ggcttcctgctggaggaccgcgtggtgtgcaacgacaagttcgccgaggacggcgcgcgc
acggtggcgcagggcaccaagaaggagggctgcaccatcctcttcatgatgctctacttc
ttcagcatggccagctccatctggtgggtcatcctgtcgctcacctggttcctggcggcc
ggcatgaagtggggccacgaggccatcgaggccaactcgcagtacttccacctggccgcc
tgggccgtgcccgccatcaagaccatcaccatcctggcgctgggccaggtggacggcgac
gtgctgagcggcgtgtgcttcgtggggctcaacaacgtggacgcgctgcggggcttcgtg
ctggcgccgctcttcgtctacctgttcatcggcacctccttcctgctggccggcttcgtg
tcgctcttccgcatccgcaccatcatgaagcacgacggcaccaagacggagaagctggag
aagctcatggtgcgcatcggcgtgttctcggtgctctacaccgtgcccgccaccatcgtc
atcgcctgctacttctacgagcaggccttccgggaccagtgggagcgcagctgggtggcc
cagagctgcaagagctacgccatcccctgcccgcacctgcaggcgggcggggccgcgccg
ccgcacccgcccatgagcccggacttcaccgtcttcatgatcaagtacctgatgacgctc
atcgtgggcatcacgtccggcttctggatctggtcgggcaagaccctcaactcctggagg
aagttctacacgcgcctccacaacagcaaacaggaggagacaacgatctga

KEGG   Oryctolagus cuniculus (rabbit): 103348917
Entry
103348917         CDS       T03373                                 

Gene name
FZD7
Definition
(RefSeq) frizzled class receptor 7
  KO
K02432  frizzled 1/7
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04150  mTOR signaling pathway
ocu04310  Wnt signaling pathway
ocu04390  Hippo signaling pathway
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04916  Melanogenesis
ocu04934  Cushing syndrome
ocu05010  Alzheimer disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05165  Human papillomavirus infection
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05217  Basal cell carcinoma
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103348917 (FZD7)
   04390 Hippo signaling pathway
    103348917 (FZD7)
   04150 mTOR signaling pathway
    103348917 (FZD7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103348917 (FZD7)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103348917 (FZD7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103348917 (FZD7)
   05205 Proteoglycans in cancer
    103348917 (FZD7)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103348917 (FZD7)
   05226 Gastric cancer
    103348917 (FZD7)
   05217 Basal cell carcinoma
    103348917 (FZD7)
   05224 Breast cancer
    103348917 (FZD7)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103348917 (FZD7)
   05022 Pathways of neurodegeneration - multiple diseases
    103348917 (FZD7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103348917 (FZD7)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103348917 (FZD7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ocu04030]
    103348917 (FZD7)
G protein-coupled receptors [BR:ocu04030]
 Frizzled / Smoothened family
  103348917 (FZD7)
SSDB
Motif
Pfam: Frizzled Fz Dicty_CAR
Other DBs
NCBI-GeneID: 103348917
NCBI-ProteinID: XP_017198531
LinkDB
Position
7
AA seq 574 aa
MRGPGAAASRSPLGLCALVLALLGALPAGAGAQPYHGEKGISVPDHGFCQPISIPLCTDI
AYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPC
RSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYP
TAPYLPDPPFTALPPGAADGRGRAAFPFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRAN
GLMYFKEEERRFARLWVGVWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYFMVA
VAHVAGFLLEDRAVCVELFSDDGYRTVAQGTKKEGCTILFMVLYFFGMASSIWWVILSLT
WFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDLLSGVCYVGLSSVDA
LRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVLYTV
PATIVLACYFYEQAFREHWERTWLLQTCKSYAVPCPPGHFPPMSPDFTVFMIKYLMTMIV
GITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV
NT seq 1725 nt   +upstreamnt  +downstreamnt
atgcggggccccggcgcggccgcgtcgcgttcgcccctgggcctgtgcgccctggtgctg
gcgctgctgggcgcgctgcccgcgggcgccggggcgcagccctaccacggcgagaagggc
atctcggtgccggaccacggcttctgccagcccatctccatcccgctgtgcacggacatc
gcctacaaccagaccatcctgcccaacctgctgggccacacgaaccaggaggacgcgggc
ctcgaggtgcaccagttctacccgctggtgaaggtgcagtgctcgcccgagctgcgcttc
ttcctgtgctccatgtacgcgcccgtgtgcaccgtgctcgatcaggccatcccgccctgc
cgctctctgtgcgagcgcgcgcgccagggctgcgaggcactcatgaacaagttcggcttc
cagtggcccgagcggctgcgctgcgagaacttcccggtgcacggcgccggcgagatctgc
gtgggccagaacacgtccgacggctccggaggccccggcggcggccccaccgcctacccc
acggcgccctacctgccggacccgcccttcaccgcgctgcccccgggggctgcggacggc
aggggccgcgccgccttccccttctcgtgcccgcgccagctcaaggtgcccccctacctg
ggctaccgcttcctgggcgagcgcgactgtggcgccccttgcgagccgggccgtgccaac
ggcctcatgtacttcaaggaggaggagaggcgcttcgcccgcctctgggtgggcgtgtgg
tccgtgctgtgctgcgcttcgaccctcttcaccgtgctcacctacctggtggacatgcgg
cgcttcagctacccagagcggcccatcatcttcctgtcgggctgctacttcatggtggcc
gtggcgcacgtggcgggcttcctgctggaggaccgcgccgtgtgcgtggagctgttctcg
gacgacggctaccgcacggtggcgcagggcaccaagaaggagggctgcaccatcctcttc
atggtgctctacttcttcggcatggccagctccatctggtgggtcatcctgtcgctcacc
tggttcctggcggccggcatgaagtggggccacgaggccatcgaggccaactcgcagtac
ttccacctggccgcgtgggccgtgccggccgtcaagaccatcaccatcctggccatgggc
caggtggacggggacctgctcagcggcgtgtgctacgtgggcctctcgagcgtggacgcg
ctgcggggcttcgtgctggccccgctcttcgtctacctcttcatcggcacctccttcctg
ctggccggcttcgtgtcgctcttccgcatccgcaccatcatgaagcacgacggcaccaag
acggagaagctggagaagctgatggtgcgcatcggcgtgttctcggtgctctacaccgtg
cccgccaccatcgtgctggcctgctacttctacgagcaggccttccgcgagcactgggag
cgcacctggctcctgcagacgtgcaagagctatgccgtgccctgcccgcccggccacttc
ccgcccatgagccccgacttcacggtcttcatgatcaagtacctgatgaccatgatcgtg
ggcatcaccacgggcttctggatctggtcgggcaagaccctgcagtcgtggcgccgcttc
taccacagactcagccacagcagcaagggggagactgcggtatga

KEGG   Oryctolagus cuniculus (rabbit): 103352372
Entry
103352372         CDS       T03373                                 

Gene name
FZD8
Definition
(RefSeq) frizzled class receptor 8
  KO
K02375  frizzled 5/8
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04150  mTOR signaling pathway
ocu04310  Wnt signaling pathway
ocu04390  Hippo signaling pathway
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04916  Melanogenesis
ocu04934  Cushing syndrome
ocu05010  Alzheimer disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05165  Human papillomavirus infection
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05217  Basal cell carcinoma
ocu05224  Breast cancer
ocu05225  Hepatocellular carcinoma
ocu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103352372 (FZD8)
   04390 Hippo signaling pathway
    103352372 (FZD8)
   04150 mTOR signaling pathway
    103352372 (FZD8)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103352372 (FZD8)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103352372 (FZD8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103352372 (FZD8)
   05205 Proteoglycans in cancer
    103352372 (FZD8)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    103352372 (FZD8)
   05226 Gastric cancer
    103352372 (FZD8)
   05217 Basal cell carcinoma
    103352372 (FZD8)
   05224 Breast cancer
    103352372 (FZD8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103352372 (FZD8)
   05022 Pathways of neurodegeneration - multiple diseases
    103352372 (FZD8)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103352372 (FZD8)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103352372 (FZD8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ocu04030]
    103352372 (FZD8)
G protein-coupled receptors [BR:ocu04030]
 Frizzled / Smoothened family
  103352372 (FZD8)
SSDB
Motif
Pfam: Frizzled Dicty_CAR PhaG_MnhG_YufB
Other DBs
NCBI-GeneID: 103352372
NCBI-ProteinID: XP_017206185
Ensembl: ENSOCUG00000029019
LinkDB
Position
Un
AA seq 283 aa
MASSIWWVILSLTWFLAAGMKWGNEAIAGYSQYFHLAAWLVPSVKSIAVLALSSVDGDPV
AGICYVGNQSLDNLRGFVLAPLVIYLFIGTMFLLAGFVSLFRIRSVIKQQGGPTKTHKLE
KLMIRLGLFTVLYTVPAAVVVACLFYEQHNRPRWEATHNCPCLRDLQPDQARRPDYAVFM
LKYFMCLVVGITSGVWIWSGKTLESWRALCTRCCWASKGTAGGGGGGGGSGAQGRGGPGG
GGAGAGPGGGGGSLYSDVSTGLTWRSGTASSGSYPKQMPLSQV
NT seq 852 nt   +upstreamnt  +downstreamnt
atggccagctccatctggtgggtcatcctgtcgctcacctggttcctggcggccggcatg
aagtggggcaacgaggccatcgccggctactcgcagtacttccacctggccgcgtggctc
gtgcccagcgtcaagtccatcgccgtgctggcgctcagctcggtggacggcgacccggtg
gcgggcatctgctacgtgggcaaccagagcctggacaacctgcgtggcttcgtgctggcg
ccgctggtcatctacctcttcatcggcaccatgttcctgctggccggcttcgtgtcgctg
ttccgcatccgctcggtcatcaagcagcagggcggccccaccaagacgcacaagctggag
aagctcatgatccgcctggggctcttcacggtgctctacaccgtgcccgccgccgtcgtg
gtcgcctgcctcttctacgagcagcacaaccggccgcgctgggaggccacgcacaactgc
ccctgcctgcgggacctgcagcccgaccaggcgcgcaggcccgactacgccgtcttcatg
ctcaagtacttcatgtgcctggtggtgggcatcacttccggggtgtggatctggtccggg
aagacgctcgagtcctggcgcgcgctctgcacgcgctgctgctgggccagcaagggcacg
gcgggcggcggcggcggcggcggcggctcgggcgcgcaggggcgcggcggcccggggggc
ggcggcgcgggcgcggggcccggcggcggagggggctcgctctacagcgacgtcagcacc
ggcctgacctggcgctcgggcacggccagctcggggtcctatccgaagcagatgcccctg
tcccaggtctga

DBGET integrated database retrieval system