KEGG   Oryctolagus cuniculus (rabbit): 100339661
Entry
100339661         CDS       T03373                                 

Gene name
PLD1
Definition
(RefSeq) phospholipase D1
  KO
K01115  phospholipase D1/2 [EC:3.1.4.4]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00564  Glycerophospholipid metabolism
ocu00565  Ether lipid metabolism
ocu01100  Metabolic pathways
ocu04014  Ras signaling pathway
ocu04024  cAMP signaling pathway
ocu04071  Sphingolipid signaling pathway
ocu04072  Phospholipase D signaling pathway
ocu04144  Endocytosis
ocu04666  Fc gamma R-mediated phagocytosis
ocu04724  Glutamatergic synapse
ocu04912  GnRH signaling pathway
ocu04928  Parathyroid hormone synthesis, secretion and action
ocu05200  Pathways in cancer
ocu05212  Pancreatic cancer
ocu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100339661 (PLD1)
   00565 Ether lipid metabolism
    100339661 (PLD1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100339661 (PLD1)
   04072 Phospholipase D signaling pathway
    100339661 (PLD1)
   04071 Sphingolipid signaling pathway
    100339661 (PLD1)
   04024 cAMP signaling pathway
    100339661 (PLD1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100339661 (PLD1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100339661 (PLD1)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100339661 (PLD1)
   04928 Parathyroid hormone synthesis, secretion and action
    100339661 (PLD1)
  09156 Nervous system
   04724 Glutamatergic synapse
    100339661 (PLD1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100339661 (PLD1)
   05231 Choline metabolism in cancer
    100339661 (PLD1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100339661 (PLD1)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.4  phospholipase D
     100339661 (PLD1)
Membrane trafficking [BR:ocu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100339661 (PLD1)
 Endosome - Golgi transport
  Others
   Others
    100339661 (PLD1)
SSDB
Motif
Pfam: PLDc_2 PLDc PX PH DUF3785
Other DBs
NCBI-GeneID: 100339661
NCBI-ProteinID: XP_017202165
Ensembl: ENSOCUG00000014089
LinkDB
Position
14
AA seq 1087 aa
MITLLTFSSMRGQTLQYHEWLRLRKTADTSVLCQYSDLLQLVSPIKGKGCYQHVLKPLCL
CLHFLGNIPFSAIYNTQGFKEPNIQTYLSGCPIKAQVLEVERFTSTTRVPGVNLYTIELT
HGEFKWQVKRKFKHFQEFHRELVKYKAFIRIPIPTRRHTFRRQNVKGEEPRNVPRLPHSS
ENAMREEQFLGRRKQLEDYLTKILKMPMYKNYHATTEFLDISQLSFIHDLGPKGIEGMIM
KRSGGHRIPGLNCCGHGRACYRWSKRWLIVKDSFLLYMKPDSGAIAFVLLVDKEFRIKVG
RKETETKYGLRIDNLSRTLILKCNSYRHARWWGGAIEEFIQKHGTNFLKDHRFGSYAAIQ
DNTLAKWYVNAKGYFEDVANAMEEAKEEIFITDWWLSPEIFLKRPVVEGNRWRLDCVLKR
KAQQGVRIFIMLYKEVELALGINSEYSKRTLMRLHPNIKVMRHPDHVSSTVYLWAHHEKL
VIIDQSVAFVGGIDLAYGRWDDNEHRLTDVGSVKRVTSGPSLGSLTVATTGSMESLSLED
KNQSNKNLPIRKSFDDVDSKLKGIGKPRRFSKFTLYKQLHRHHLHNTDSISSIDSASSYF
NHYRSHQNLIHGLKPHLKLFRPSSESEQGLTRPDIDAGSIRSLQTGVGELHGETRFWHGK
DYCNFVFKDWVQLDKPFADFIDRYSTPRMPWHDIASAVHGKAARDVARHFIQRWNFTKIM
KPKYRSLSYPFLLPKSQMTAHELRYQVPGAVNAKVQLLRSAADWSAGIKYHEESIHAAYV
HVIENSKHYIYIENQFFISCADDKVVFNKVGDAIARRILKAHRENRRYRVYVVIPLLPGF
EGDISTGGGNALQAIMHFNYRTMCRGEDSILGQLKAELGNQWINYISFCGLRTHAELEGN
LVTELIYVHSKLLIADDNTVIIGSANINDRSMLGKRDSEMAVIVQDTETVPSVMDGEEYQ
AGRFAQGLRLQCFRVVLGYLSDPSEDIQDPVSDKFFKEIWVSTAARNATIYDKVFRCLPN
DEVHNLIQLRDFITKPILAKEDPSRAEEELKKIRGFLVQFPFYFLSEESLLPSIGTKEAI
VPMEVWT
NT seq 3264 nt   +upstreamnt  +downstreamnt
atgatcactctcctcactttctcctccatgaggggtcagaccctgcagtatcacgagtgg
ctcaggctcaggaagacagctgacacttcagtactgtgtcagtactccgacctcttgcag
ttggtgtcacctataaaaggcaagggatgctaccagcacgtattgaaaccactttgtttg
tgtcttcattttttagggaacatccccttctctgcgatttataacactcaaggatttaaa
gagcccaacattcagacgtacctctctggctgtcccatcaaagcgcaggttttggaagtg
gagcgcttcacctctacaacaagggtgccaggtgtcaatctttacaccattgaattgaca
catggggaatttaaatggcaggttaagaggaaattcaagcacttccaagaattccacaga
gagttggtcaagtacaaagccttcatccgaatccccattcccaccagaagacacacattt
agaagacagaatgtcaaaggggaggagcctcggaatgtgcccaggctgccccattcatct
gaaaacgcgatgagagaagaacagttcttgggaaggcggaaacaactagaagattacttg
acaaagatactgaaaatgcccatgtataaaaattatcatgccacaacagaattccttgat
ataagccagttgtctttcatccatgatttgggaccaaagggcatagaaggcatgataatg
aaaagatctggaggacacagaataccaggtttgaattgctgtgggcacggacgagcttgc
taccgctggtcaaaaaggtggctaattgtgaaagattcctttttactctatatgaaacca
gacagtggggctattgcctttgtcctgctggtggataaagaattcagaattaaggtgggg
agaaaggagacggaaacaaagtatggactccgaatcgataatctttcaaggacacttatt
ttaaaatgcaacagctacagacatgctcggtggtggggaggggctatagaggaattcatc
cagaaacatggcaccaactttctcaaagaccatcgatttgggtcttatgctgctatccaa
gataacactttagctaaatggtatgttaatgccaagggatattttgaagatgtggcaaat
gcaatggaagaggcaaaagaagagatttttatcacagattggtggttgagtccagagatc
ttcctgaaacgccccgtggttgaaggaaatcgctggaggttggactgtgttctgaaacga
aaagcacaacagggagtgaggatcttcataatgctctacaaagaggtggaacttgctctt
ggaatcaatagtgaatatagcaagaggaccttaatgcgtctacaccccaacataaaggtg
atgcggcacccggatcacgtgtcgtccaccgtctatctgtgggctcatcacgagaaactc
gtcatcatcgaccagtcagtggctttcgtgggtgggattgacctggcctatggcaggtgg
gatgacaatgagcacaggctgacggacgtgggcagcgtgaagcgtgtcacctcagggccg
tctctgggttccctcacggttgcaacaacagggtctatggagtctttaagtctcgaagat
aaaaatcaatccaataaaaatctgcccatccggaagagttttgatgatgtggattcaaaa
ttaaaaggaataggaaagccaaggaggttctccaaatttaccctctataagcagctccac
aggcaccacctgcacaacaccgacagcatcagcagtattgacagtgcctccagttatttt
aatcactatagaagccatcagaatttaatccatggtttaaaaccccacttgaaactcttt
cgcccgtccagtgagtctgagcagggactcactagacctgacattgacgctggctccatc
cgcagtttgcagacaggcgtgggcgagctacatggggaaacgagattctggcacgggaag
gactactgcaactttgtcttcaaagactgggtccagctcgataaacctttcgctgatttc
atcgacaggtactccactccccggatgccctggcacgacattgcgtccgcagtgcacggg
aaggcggctcgggatgtggcgcgtcacttcatccagcgctggaacttcacgaagattatg
aaacccaaatatcggtccctttcttaccctttcctgctgccaaagtctcagatgacagcc
catgagctgagataccaagttcctggggctgtaaatgctaaggtgcagttgctccggtct
gccgctgactggtctgctgggatcaagtaccatgaagagtctatccacgctgcttacgtc
catgtgatagagaacagcaaacactatatctatatcgagaaccagtttttcataagctgt
gctgatgacaaagttgtgttcaacaaggtgggcgatgccattgcccggcggatcctgaaa
gcgcacagggagaaccggaggtaccgggtgtatgttgtgataccacttctgccaggattt
gaaggagacatctccactggcggaggaaatgctctgcaggccataatgcacttcaactac
agaaccatgtgcagaggagaagattccatccttggacagttaaaagctgagctgggtaat
cagtggataaactacatatcattctgtggccttagaacgcatgcagagctagaaggaaac
ctggtcactgagctgatctatgtccacagcaagttgctaattgctgatgataacactgtt
attattggctctgccaacatcaatgaccgaagcatgctgggtaagcgggacagtgagatg
gctgtcattgtccaggacacagagacggtgccttccgtcatggatggggaagagtaccag
gccggccgcttcgcccagggactccggctacagtgcttcagggttgtcctgggctatctt
tctgaccccagcgaggacattcaggatcctgtgagcgacaaattcttcaaggagatatgg
gtttcaacagcagctcgaaatgctacaatttatgataaggtgttccggtgcctacccaat
gacgaggtacacaacttaattcagctgagagactttataaccaagcccatattagcaaag
gaagatcccagtagagctgaagaggaactgaaaaagatccgcgggttcttggtgcagttc
cccttttatttcttgtctgaagaaagtctactgccttccattggaaccaaagaagccata
gtgcctatggaggtttggacttaa

KEGG   Oryctolagus cuniculus (rabbit): 103351480
Entry
103351480         CDS       T03373                                 

Definition
(RefSeq) phospholipase D2
  KO
K01115  phospholipase D1/2 [EC:3.1.4.4]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00564  Glycerophospholipid metabolism
ocu00565  Ether lipid metabolism
ocu01100  Metabolic pathways
ocu04014  Ras signaling pathway
ocu04024  cAMP signaling pathway
ocu04071  Sphingolipid signaling pathway
ocu04072  Phospholipase D signaling pathway
ocu04144  Endocytosis
ocu04666  Fc gamma R-mediated phagocytosis
ocu04724  Glutamatergic synapse
ocu04912  GnRH signaling pathway
ocu04928  Parathyroid hormone synthesis, secretion and action
ocu05200  Pathways in cancer
ocu05212  Pancreatic cancer
ocu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    103351480
   00565 Ether lipid metabolism
    103351480
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    103351480
   04072 Phospholipase D signaling pathway
    103351480
   04071 Sphingolipid signaling pathway
    103351480
   04024 cAMP signaling pathway
    103351480
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103351480
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    103351480
  09152 Endocrine system
   04912 GnRH signaling pathway
    103351480
   04928 Parathyroid hormone synthesis, secretion and action
    103351480
  09156 Nervous system
   04724 Glutamatergic synapse
    103351480
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103351480
   05231 Choline metabolism in cancer
    103351480
  09162 Cancer: specific types
   05212 Pancreatic cancer
    103351480
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.4  phospholipase D
     103351480
Membrane trafficking [BR:ocu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    103351480
 Endosome - Golgi transport
  Others
   Others
    103351480
SSDB
Motif
Pfam: PLDc PLDc_2
Other DBs
NCBI-GeneID: 103351480
NCBI-ProteinID: XP_008269052
LinkDB
Position
19
AA seq 513 aa
MLLHPNVKVMRHPDQVTLWAHHEKLLVVDQVVAFLGGLDLAYGRWDDLHYRLTDLDNSSE
SATAQPHLPQPDPEASPDLSHNHLFWLGKDYSNLIAKDWVQLDRPFEDFIDRETTPRMPW
RDIGVVVHGPPARDLARHFIQRWNFTKTTKAKYKIPMYPYLLPKSTSTANHLPFTISGGQ
CTTVQVLRSVDRWSAGTSESSILNAYLHTIRESRHFLYIENQFFISCSDGRSVLNKVGDE
IVDRILKAHNQGQRFRVYVLLPLLPGFEGDISTGGGNSIQAILHFTYRTLCRGEYSILHR
LKAAMGTAWRDYISICGLRTHGELGGHPVSELIYIHSKMLIADDRTVIIGSANINDRSLL
GKRDSELAVLIEDTEMEPSLMDGAEYQAGRFALSLRKHCFSVILGANARPDLDLRDPVCD
DFFQLWQATAENNANIYEQIFRCLPSNATRSLRTLREYVAVEPLAVVSPPLARSELTQVQ
GHLVHFPLKFLEDESLLPPLGSKEGMIPLEVWT
NT seq 1542 nt   +upstreamnt  +downstreamnt
atgctgctgcaccccaacgtaaaggtgatgcggcacccagaccaggtgacgctgtgggct
caccatgagaagctgctggtggtggaccaggtggtggccttcttgggggggctggacctt
gcctacgggcgctgggacgacctgcactacagactgacagaccttgacaactcttctgag
tcagccaccgcccagcctcacctgccacagccagaccctgaagcctccccagacctgtct
cacaaccacctcttctggctgggcaaggactacagcaacctcattgccaaggactgggtg
cagctggaccggccttttgaagatttcattgacagggagaccaccccccggatgccatgg
cgggacatcggggtggttgtccatggcccacctgcccgtgaccttgcccgccacttcatc
cagcgatggaacttcaccaagaccaccaaggccaagtacaagatacccatgtacccctac
ctgctgcccaagtccaccagcactgcaaaccatctccctttcaccatctccgggggacag
tgcaccactgtgcaggtcctgcggtccgtggaccgctggtcagcgggcacttcggagagc
tccatcctcaatgcgtacctgcacaccatccgggagagccgccacttcctctacattgag
aaccagttcttcattagctgctcagatgggcggtcggttctgaacaaggtgggcgatgag
atcgtggacagaattctgaaggcccacaaccaggggcagcgtttccgggtctatgtgctt
ttgcccctgctccctggcttcgagggcgacatctctacaggcgggggcaactccatccag
gccattctgcacttcacctacaggaccctgtgtcgtggggagtattccatactgcaccgc
ctcaaagcagccatggggacagcgtggcgggactacatatccatctgcggactccgcacc
cacggagagctgggcgggcacccggtctcagagctcatctacatccacagcaagatgctc
attgcggacgaccgcacagtcatcatcggttctgccaacatcaatgaccggagcttgctg
gggaagcgggacagtgagctggctgtgctgattgaggacacagagatggagccgtccctc
atggatggggccgagtaccaggcaggcagattcgccttgagtttgcgcaaacactgcttc
agtgtgattcttggcgcaaatgcccggccggacctggatctccgagaccctgtgtgtgac
gacttcttccagttgtggcaagcaacagcggaaaacaatgccaatatctacgagcagatc
ttccgctgcctgccatccaatgccacgcgctccctgcggactctccgggagtacgtggcc
gtggagcccctggccgtggtcagccctcccttggccaggtcggagctcacccaggtccag
ggccacttggtccacttccccctcaagttcctggaggatgagtctttgctgccgccgctg
ggcagcaaggaaggcatgattcccctggaggtgtggacgtag

DBGET integrated database retrieval system