KEGG   Oryctolagus cuniculus (rabbit): 100339723
Entry
100339723         CDS       T03373                                 

Gene name
DDX19A
Definition
(RefSeq) DEAD-box helicase 19A
  KO
K18655  ATP-dependent RNA helicase DDX19/DBP5 [EC:3.6.4.13]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03013  RNA transport
ocu03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    100339723 (DDX19A)
   03015 mRNA surveillance pathway
    100339723 (DDX19A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100339723 (DDX19A)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     100339723 (DDX19A)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     100339723 (DDX19A)
SSDB
Motif
Pfam: DEAD Helicase_C ResIII
Other DBs
NCBI-GeneID: 100339723
NCBI-ProteinID: XP_002711762
UniProt: A0A5F9DI37
LinkDB
Position
5
AA seq 478 aa
MATDSWALAVDEQEAAVKSISSLQIKEEKVKPETNGVVKTSTSAEKTDEDEKEDRAAQSL
LNKLIRSNLVDNTNQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQEN
ALPMMLAEPPQNLIAQSQSGTGKTAAFVLAMLSRVEPADRHPQCLCLSPTYELALQTGKV
IEQMGKFHPELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVL
DEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNIIKLKREE
ETLDTIKQYYVLCNNRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVA
LLSGEMVVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNE
TYLHRIGRTGRFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLDEIEKIAN
NT seq 1437 nt   +upstreamnt  +downstreamnt
atggccaccgactcgtgggccctggcggtggacgagcaggaagcggctgtcaagtcgata
agcagtttgcagatcaaggaagagaaagtcaaaccagaaaccaatggtgttgtcaaaacc
agtacctcagcagagaagacagatgaagacgagaaagaggacagagctgcccagtccttg
ctcaacaagctgatcagaagcaaccttgtggataacacaaaccaagtggaagtcctacag
cgggatcccaactccccgctctactctgtgaagtcttttgaggagctgcggctgaaacca
cagcttctccagggagtatatgccatgggcttcaatcgaccatccaagatccaagagaat
gcattacccatgatgcttgctgaacccccacagaatctcatcgcccagtctcagtctggt
actgggaaaacagctgctttcgtcctggccatgcttagtcgagtggaaccagcagacaga
caccctcagtgtctgtgcctctccccaacatatgagctggcacttcaaactggtaaagtg
attgagcagatgggcaaatttcatccagaactaaagcttgcttatgctgttcgaggcaat
aaattggaaagagggcagaagatcagtgagcagattgtcattggcaccccagggactgtc
ctggactggtgctccaaactcaagttcattgaccccaagaagatcaaggtgtttgttctg
gacgaggctgacgtgatgatagccactcagggccaccaggatcagagcatccgcatccag
aggatgctgcccaggaactgccagatgctccttttctctgcgacctttgaagactctgtg
tggaagtttgcccagaaagtggtcccagacccgaacattatcaaactgaagcgcgaggag
gagactttggataccatcaagcagtactacgtcctgtgcaacaacagagatgagaagttc
caggccctgtgcaacctgtatggggccatcaccatcgctcaggccatgatcttctgccac
acccgcaaaacagccagctggttggcagcagagctgtcaaaggaaggccaccaggtggcc
ctgctgagcggagaaatggtggtggagcagagagcagccgtgattgagcgcttccgagag
ggcaaagagaaggttctggtgaccaccaacgtgtgtgcccgcggtatcgatgttgaacaa
gtgtctgtcgtgatcaactttgatcttcccgtggacaaggatgggaacccagacaatgag
acctacctgcaccggatcgggcgcaccggccgctttggcaagaggggcctggccgtgaac
atggttgacagcaagcacagcatgaacatcctgaacagaatccaggagcattttaataag
aagatagaaagactggacacggatgatttggatgagattgagaaaatagccaactga

KEGG   Oryctolagus cuniculus (rabbit): 100340393
Entry
100340393         CDS       T03373                                 

Definition
(RefSeq) ATP-dependent RNA helicase DDX19B
  KO
K18655  ATP-dependent RNA helicase DDX19/DBP5 [EC:3.6.4.13]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03013  RNA transport
ocu03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    100340393
   03015 mRNA surveillance pathway
    100340393
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100340393
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     100340393
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Other transport factors
     100340393
SSDB
Motif
Pfam: DEAD Helicase_C ResIII
Other DBs
NCBI-GeneID: 100340393
NCBI-ProteinID: XP_002711765
UniProt: A0A5F9CDT8
LinkDB
Position
5
AA seq 484 aa
MAGATGRFRGRAMGRFPLTLPVADLSNLHLKDEKIKPDANGAVVKTNANTENTDEEEKED
RAAQSLLNKLIRSNLVDNTNQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRP
SKIQENALPLMLAEPPQNLIAQSQSGTGKTAAFVLAMLSQVEPANKYPQCLCLSPTYELA
LQTGKVIEQMGRFYPELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKK
IKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNII
KLKREEETLDTIKQYYVLCNNRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSK
EGHQVALLSGEMVVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKD
GNPDNETYLHRIGRTGRFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLDEIE
KIAN
NT seq 1455 nt   +upstreamnt  +downstreamnt
atggctggggcgactggccgtttccgaggtcgagccatggggcggtttccgctcaccctg
ccggtggccgatttgagcaacttgcatcttaaggacgagaaaatcaaaccggatgccaat
ggtgctgttgtcaagaccaatgctaatacagagaacacagatgaagaagaaaaagaggac
agagctgcccagtcattgctcaacaaactgatcagaagcaaccttgtggataacacaaac
caagtggaagtcctacagcgggatcccaactcccccctctactctgtgaagtcttttgag
gagctccggctgaaaccgcaacttctccagggagtctatgccatgggtttcaaccggcca
tccaagatccaagagaacgctttgcctttgatgcttgctgaacccccacagaatttaatt
gcccagtctcagtctggtactggtaaaacagctgcttttgtgttggccatgctcagccaa
gtggaacctgcgaacaaatatccccagtgtctgtgcctttccccaacatatgaacttgcc
cttcaaaccggaaaagtgattgagcagatgggcagattttaccctgaactgaaactagct
tatgctgttcgaggcaataaattggaaagagggcagaagatcagtgagcagattgtcatt
ggcaccccagggactgtcctggactggtgctccaaactcaagttcattgaccccaagaag
atcaaggtgtttgttctggacgaggctgacgtgatgatagccactcagggccaccaggat
cagagcatccgcatccagaggatgctgcccaggaactgccagatgctccttttctctgcg
acctttgaagactctgtgtggaagtttgcccagaaagtggtcccagacccgaacattatc
aaactgaagcgcgaggaggagactttggataccatcaagcagtactacgtcctgtgcaac
aacagagatgagaagttccaggccctgtgcaacctgtatggggccatcaccatcgctcag
gccatgatcttctgccacacccgcaaaacagccagctggttggcagcagagctgtcaaag
gaaggccaccaggtggccctgctgagcggagaaatggtggtggagcagagagcagccgtg
attgagcgcttccgagagggcaaagagaaggttctggtgaccaccaacgtgtgtgcccgc
ggtatcgatgttgaacaagtgtctgtcgtgatcaactttgatcttcccgtggacaaggat
gggaacccagacaatgagacctacctgcaccggatcgggcgcaccggccgctttggcaag
aggggcctggccgtgaacatggttgacagcaagcacagcatgaacatcctgaacagaatc
caggagcattttaataagaagatagaaagactggacacggatgatttggatgagattgag
aaaatagccaactga

DBGET integrated database retrieval system