KEGG   Oryctolagus cuniculus (rabbit): 100339791
Entry
100339791         CDS       T03373                                 

Gene name
SMG7
Definition
(RefSeq) SMG7, nonsense mediated mRNA decay factor
  KO
K14409  protein SMG7
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100339791 (SMG7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100339791 (SMG7)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Other surveillance  factors
     100339791 (SMG7)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100339791 (SMG7)
SSDB
Motif
Pfam: EST1_DNA_bind EST1 zf-AD TPR_2 TPR_7
Other DBs
NCBI-GeneID: 100339791
NCBI-ProteinID: XP_017195198
Ensembl: ENSOCUG00000005887
LinkDB
Position
Un
AA seq 1160 aa
MFWQIVIVGENVSCKSQMRTENLKSEERLKSSTIRQAEVLKADMTDSKLGPAEVWTSRQA
LQDLYQRMLVTDLEYALDKKVEQDLWNHAFKNQITTLQGQAKNRANPNRSEVQANLSLFL
EAASGFYTQLLQELCTVFNVDLPCRVKSSQLGIISNKQTHTSAIVKPQSSSCSYICQHCL
VHLGDIARYRNQTSQAESYYRHAAQLVPSNGQPYNQLAILASSKGDHLTTIFYYCRSIAV
KFPFPAASTNLQKALSKALESRDEVKTKWGVSDFIKAFIKFHGHVYLSKSLEKLGPLREK
LEEQFKRLLFQKAFNSQQLVHVTVINLFQLHHLRDFSSETEQHSYSPDEQLCWTQLLALF
MSFLGVLCKCPLQAESQEEPSSAFPLPAVKVSMDWLRLRPRVFQEAVVDERQYIWPWLIS
LLNSFHPQEEDLSSTNATPLPEEFELQGFLALRPSFRNLDFSKGHQGLTGDKEGQQQRVR
QQRLISIGKWIADNQPRLIQCENEVGKLLFITEIPELILEDPSEAKENLIVQDTSVVEAL
AADGSPGLKSMLSTGRGDAGEKPAVTFKESAKPREVTRDPGRSFPPKEAKSQTELRKTPV
SEARKTPVTQTPSQASTSQFIPIHHPGAFPPLPSRPGFPPPTYVIPPPVAFSVGSGYTFP
AGVSVPGTFLQSAAHAPAGSQVQAGKQSHIPYSQQRPSGPGPVSQGPQQAQPPCQQPLAS
LPAQPAAQPTSQVQVPAPAPPQQSPTKAGPALGKSSPPHSGFQQYQQADASKQLWNPPQV
QGPLGKILPVKQPCYLQTQDPVKLFEPSLQPPVMQQPPLEKKMKPFPLEPYNHSPSEVKV
PELYWDSAYSVADSRAVMPQPANVDRRGKRPPGVFRPEQDPVPRMPFEDPKGSPLLPPDL
LQSLAALEDEEELIFSNPPDLCPALLGPLASLPGRSLFKSLLEKPSELMSHSSSFLSLTG
FSLSQDRHPSSSVFSEVYGKNLAAGSKAELSPALAPQETSLYSLFEGTPWSPPLPASSDH
STPASQSPHSSNPSSLPSSPPTHNHNSVPFSNFGPIGTPDNRDRRTGDRWKTDKPAMGGF
GIDYLSAAPSSESSWRQAGTPASTWAGHGPSVEDSSAVLMESLKSIWSSSMTRPGPSALE
QLLMQQQQQQRGRGALNPPH
NT seq 3483 nt   +upstreamnt  +downstreamnt
atgttctggcagatagtcattgtgggagaaaacgtttcatgtaagtcccagatgaggacc
gaaaacttgaaatcagaggagcgtctgaaatcgagtactattaggcaggcagaagtcctg
aaggctgacatgacagattctaagctggggccggcggaggtctggacttccaggcaggct
ctgcaagacctctaccagagaatgctggtgactgatttggagtacgctctagacaagaaa
gtagagcaggatctctggaatcatgcctttaagaatcagatcacaacactgcaaggccag
gcaaagaatcgagcaaacccgaatcggagtgaagtgcaggcaaacctctccctgttccta
gaggcagctagtggcttctacacgcagttattacaagaactgtgtacagtgttcaatgta
gatttaccgtgtcgtgtgaagtcttcccaactgggaattatcagcaataaacagacacat
acaagcgccatagtgaagccgcagtccagttcctgttcctacatctgccagcactgcctc
gtccaccttggagacattgctcgatacagaaaccagaccagccaggcagaatcctactat
cgacacgcagctcagctcgtcccctccaatggtcagccctacaaccagttggccatcctg
gcttcctccaaaggagaccacctgaccaccatcttctactactgcagaagcattgctgtg
aagttccccttcccagccgcctccacgaacctgcagaaagcactttctaaagccctggag
agccgggatgaggtgaaaaccaagtggggtgtttctgacttcatcaaggccttcattaag
ttccacgggcacgtgtacctgagtaagagcctggaaaagttgggccctcttcgagagaag
ttggaagaacagtttaagaggctgctgttccagaaggcgttcaactcgcagcagttggtg
cacgtcaccgtcattaacctgttccagctgcaccacctccgtgacttcagcagcgaaaca
gagcagcacagctacagcccagacgagcagctgtgttggactcagttgctggccctcttt
atgtctttcctcggcgtcctgtgcaagtgtcctctccaggctgagtctcaggaggagccc
agcagcgccttcccgcttcctgcggtcaaggtctccatggactggctgcggctcagaccc
cgtgtcttccaggaggcggtggtggacgagaggcagtacatttggccctggctgatttct
cttctaaatagtttccacccccaggaggaggacctctccagcactaatgctactccactt
ccagaggagtttgagcttcaaggatttttggccttgagaccttctttcaggaacttggat
ttctccaaaggccaccagggtctcaccggagacaaagaggggcagcagcagcgggtacgg
cagcagcgcttgatctccataggcaagtggattgccgacaatcagcccaggctgattcag
tgtgaaaatgaggtagggaaattgttgtttatcacagaaatcccagagttaatactggag
gatcccagtgaagccaaagagaacctcattgtgcaagacacgtccgtggtagaggcgttg
gctgccgacgggagcccagggctgaaatcaatgctgtctacaggccgtggtgacgcggga
gagaaaccagcggtcaccttcaaagagagcgcgaagccacgagaagtgaccagagaccca
ggcagaagtttccctcccaaagaggcgaaatcccagacagagctgagaaagacccccgtg
tctgaagccaggaagacccctgtcacgcagaccccgagccaagccagcacctcccagttc
atccccattcaccaccctggagccttcccccccctccccagccggccagggttcccgccc
ccaacatacgttatcccccctcctgtggcattctctgtgggctcaggttacaccttccca
gctggtgtttctgtcccaggaacctttctgcagtctgcagctcacgctccagcaggaagc
caggtgcaagctgggaaacagtcccacattccttacagccagcagcggccctcgggacca
gggccagtgagccagggacctcagcaggcacagccgccttgccagcagccccttgcgtct
ctaccagctcagccagcagcacagcccacaagccaggtgcaggttccagccccagctccg
ccgcagcagtcccccacaaaggccgggccggccctggggaagagctcgcctccccactcg
ggattccagcagtatcaacaggcagatgcctccaaacagctgtggaatccccctcaggtg
caaggccctttagggaaaatcctgcccgtgaaacagccctgctaccttcagacccaagac
cccgtgaagctctttgagccgtcattgcaacctccagtgatgcagcagccgcctctcgag
aaaaaaatgaagcctttccccctggagccatataaccacagcccctcagaagtcaaagtc
ccggagctctactgggactccgcctacagcgtggcagacagccgcgccgtcatgccacag
ccagcaaacgtggaccgcaggggcaagcggccacccggagtcttccgtccagagcaggat
cccgtgcccaggatgccgttcgaggaccccaagggctcccctctgctccccccggacctg
ttacagagcctggctgccctagaggacgaggaggagctcatcttttccaaccctcccgac
ctttgcccagcccttctggggcctctcgcctctctccccggacggagcctctttaaatcc
ttgttggagaagccgtcggagctcatgtcgcactcgtcctccttcctgtctctcaccggc
ttctccctcagtcaggacaggcacccgagcagcagtgtgttcagcgaggtgtacgggaag
aacctggcggctggctccaaagcagagctgagccccgccctggccccccaggaaacgtca
ctgtactccctgttcgaagggaccccgtggtctccgccacttcctgccagttcagatcac
tcgacaccagccagccagtctcctcattcctccaacccgagcagcctgcccagctctcct
ccaacacacaaccataactccgtccccttctccaattttggacccattgggactccagat
aacagggacaggaggactggagaccggtggaaaacggacaagccagccatgggtgggttt
ggcatcgattacctctcggcagcgccatcctctgagagcagctggcgtcaggcgggcacg
cccgccagcacctgggcgggccacggcccctccgtggaggactcctctgctgtcctcatg
gaaagcctgaagtccatctggtccagctccatgacgcgccctggaccgtccgcgctggag
cagctcttgatgcagcagcagcagcagcagcggggccgaggcgccctgaaccctccacac
tga

DBGET integrated database retrieval system