KEGG   Oryctolagus cuniculus (rabbit): 100339832
Entry
100339832         CDS       T03373                                 

Gene name
NCBP2
Definition
(RefSeq) nuclear cap binding protein subunit 2
  KO
K12883  nuclear cap-binding protein subunit 2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03013  RNA transport
ocu03015  mRNA surveillance pathway
ocu03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    100339832 (NCBP2)
  09122 Translation
   03013 RNA transport
    100339832 (NCBP2)
   03015 mRNA surveillance pathway
    100339832 (NCBP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100339832 (NCBP2)
   03041 Spliceosome [BR:ocu03041]
    100339832 (NCBP2)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA processing factors
   5' end processing
    Cap binding complex
     100339832 (NCBP2)
Spliceosome [BR:ocu03041]
 Common components
  Common spliceosomal components
   Cap binding complex
    100339832 (NCBP2)
SSDB
Motif
Pfam: RRM_1 RRM_occluded RRM_5
Other DBs
NCBI-GeneID: 100339832
NCBI-ProteinID: XP_002716573
Ensembl: ENSOCUG00000006738
UniProt: G1SRL2
LinkDB
Position
14
AA seq 156 aa
MSGGLLKALRSDSYVELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELF
SKSGDIKKIIMGLDKVKKTACGFCFVEYYSRADAENAMRYINGTRLDDRIIRTDWDAGFK
EGRQYGRGRSGGQVRDEYRQDYDAGRGGYGKLAQNQ
NT seq 471 nt   +upstreamnt  +downstreamnt
atgtcgggaggccttctgaaggcgctgcgcagtgactcctacgtggagctgagccagtac
cgggaccagcacttccggggtgacaatgaagaacaagaaaaattactgaagaaaagctgt
acattatatgttggaaatctttccttttacacaactgaagaacaaatttatgaactcttc
agtaaaagtggtgacataaagaaaattattatgggtctggataaagtgaaaaaaacagca
tgtggattttgttttgtggaatactattcaagagcagatgcagaaaatgccatgcggtac
ataaatgggactcgtctggatgaccggatcattcgtacagactgggacgcaggctttaag
gagggcaggcagtatggacgtggtcgctccgggggccaggtgcgagatgagtatcggcag
gactatgatgctgggagaggaggatatggcaaactggcacaaaaccagtga

DBGET integrated database retrieval system