KEGG   Oryctolagus cuniculus (rabbit): 100339842Help
Entry
100339842         CDS       T03373                                 

Gene name
GSTO2
Definition
(RefSeq) glutathione S-transferase omega-2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00480  Glutathione metabolism
ocu00980  Metabolism of xenobiotics by cytochrome P450
ocu00982  Drug metabolism - cytochrome P450
ocu00983  Drug metabolism - other enzymes
ocu01100  Metabolic pathways
ocu01524  Platinum drug resistance
ocu05200  Pathways in cancer
ocu05204  Chemical carcinogenesis
ocu05225  Hepatocellular carcinoma
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    100339842 (GSTO2)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100339842 (GSTO2)
   00982 Drug metabolism - cytochrome P450
    100339842 (GSTO2)
   00983 Drug metabolism - other enzymes
    100339842 (GSTO2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100339842 (GSTO2)
   05204 Chemical carcinogenesis
    100339842 (GSTO2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100339842 (GSTO2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100339842 (GSTO2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100339842 (GSTO2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ocu02000]
    100339842 (GSTO2)
Enzymes [BR:ocu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100339842 (GSTO2)
Transporters [BR:ocu02000]
 Other Transporters
  Pores ion channels [TC:1]
   100339842 (GSTO2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 Glutaredoxin GST_C_3 GST_C
Motif
Other DBs
NCBI-GeneID: 100339842
NCBI-ProteinID: XP_008268705
Ensembl: ENSOCUG00000008708
LinkDB All DBs
Position
18
AA seq 244 aa AA seqDB search
MSKDATRTLGKGSCPPGPVPEGLIRIYSMRFCPYSHRTRLVLKAKGIRHEVININLKNKP
EWYYTKHPYGQIPVLENSQCQLIYESVIACEYLDDAYPGRKLFPYDPYERARQKMLLELF
CKVPHLTKECLVALRCGRECSDLKTALRQEFCNLEEILDYQNTTFFGGDCISMIDYLLWP
WFERLDVYGIADCVNHTPTLRLWIAAMKQDPTVCALLIDKNIFLGFLNLYFQNNPNAFDF
GLVC
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaggatgcgaccagaaccctggggaaaggaagctgccctccagggccggtccct
gagggcctgatccgcatctacagcatgaggttctgcccctactcgcatagaacacgcctc
gtcctcaaggccaaaggcataagacacgaagttatcaacattaacctgaaaaacaagcct
gaatggtactacacaaagcatccttacggccaaattccagtcttggagaacagccagtgt
caactgatctatgaatcggtcatcgcctgtgagtacctggacgacgcgtatccgggaagg
aagctgtttccgtacgacccttacgaacgagctcgacaaaagatgttgctggagctgttc
tgtaaggtcccacatctaactaaggagtgtctggtggccttgagatgtgggagggaatgc
agcgatctgaagacagccctgcgtcaggaattctgcaacttggaagagattcttgactac
cagaacaccaccttcttcgggggcgactgtatatccatgatcgactacctgctctggccc
tggtttgagcggctggatgtgtatgggatagcagactgtgtgaaccacaccccgacactg
cggctctggattgcagccatgaagcaagaccccaccgtctgtgccctcctcatagacaag
aacattttcctgggcttcttgaacctgtatttccagaacaaccctaatgcctttgacttt
gggctagtctgctga

DBGET integrated database retrieval system