KEGG   Oryctolagus cuniculus (rabbit): 100339859Help
Entry
100339859         CDS       T03373                                 

Gene name
PRSS2
Definition
(RefSeq) protease, serine 2
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04080  Neuroactive ligand-receptor interaction
ocu04972  Pancreatic secretion
ocu04974  Protein digestion and absorption
ocu05164  Influenza A
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100339859 (PRSS2)
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    100339859 (PRSS2)
   04974 Protein digestion and absorption
    100339859 (PRSS2)
 09160 Human Diseases
  09167 Infectious diseases
   05164 Influenza A
    100339859 (PRSS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ocu01002]
    100339859 (PRSS2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100339859 (PRSS2)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     100339859 (PRSS2)
Peptidases [BR:ocu01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100339859 (PRSS2)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100339859 (PRSS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 100339859
NCBI-ProteinID: XP_002721891
Ensembl: ENSOCUG00000001950
UniProt: G1SGH0
LinkDB All DBs
Position
Un
AA seq 246 aa AA seqDB search
MHPLLILAFVGAAVAFPVDDDDKIVGGFTCAENSVPYQVSLNSGYHFCGGSLINDQWVVS
AAHCYKYRIQVRLGEHNIEVEEGGEQFINSAKVIRHPKYNSWTLDNDILLIKLSSPATIS
SRVATISLPSSCAPAGTQCLITGWGNTLSSGVNYPDLLQCLYAPLLSQADCEASYPGEIT
SNMICAGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCAQKNKPGVYTKVCNYVDWIQ
QTIAAN
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgcacccactcctgatcctcgcctttgtgggagcggctgtcgctttccccgttgacgac
gatgacaagatcgtcgggggcttcacctgtgcggagaattccgtcccctaccaggtgtcc
ctgaactccggctaccacttctgcgggggctccctcatcaatgaccagtgggtggtgtca
gcggctcactgctacaagtaccgcatccaggtaagactgggagagcacaacattgaagtc
gaggaggggggcgagcagttcatcaactcggccaaggtcatccgccaccccaagtacaac
agctggaccctggacaatgacatcttgctgatcaagctctcctcgcctgccaccatcagt
agccgggtggccaccatctctctgcccagctcctgtgcacctgctggcacccaatgcctc
atcactggctggggcaacaccctgagctctggtgtcaactacccagacctgctgcagtgc
ctgtacgccccgctgctgagtcaggccgactgtgaagcctcctaccctggcgagatcacc
agcaacatgatctgtgccggcttccttgagggaggcaaggattcctgccagggtgactcc
ggtggccccgtggtctgcaatggagagctccaaggcattgtgtcctggggctacggctgt
gcccagaagaacaagcctggagtctacaccaaggtctgcaactacgtggactggattcag
cagaccatcgctgccaactaa

DBGET integrated database retrieval system