KEGG   Oryctolagus cuniculus (rabbit): 100339936
Entry
100339936         CDS       T03373                                 

Gene name
NXT2
Definition
(RefSeq) nuclear transport factor 2 like export factor 2
  KO
K14285  NTF2-related export protein 1/2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03008  Ribosome biogenesis in eukaryotes
ocu03013  RNA transport
ocu03015  mRNA surveillance pathway
ocu05014  Amyotrophic lateral sclerosis
ocu05164  Influenza A
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    100339936 (NXT2)
   03015 mRNA surveillance pathway
    100339936 (NXT2)
   03008 Ribosome biogenesis in eukaryotes
    100339936 (NXT2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100339936 (NXT2)
  09172 Infectious disease: viral
   05164 Influenza A
    100339936 (NXT2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100339936 (NXT2)
   03009 Ribosome biogenesis [BR:ocu03009]
    100339936 (NXT2)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     100339936 (NXT2)
Ribosome biogenesis [BR:ocu03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    100339936 (NXT2)
SSDB
Motif
Pfam: NTF2
Other DBs
NCBI-GeneID: 100339936
NCBI-ProteinID: XP_002720232
Ensembl: ENSOCUG00000008261
UniProt: G1SUT3
LinkDB
Position
X
AA seq 197 aa
MRKFRRDWSQEDYERRQGRSDYRHEEPQTSYSYRGGHRREEVVTPPLDQSASGSSMATSV
DFKTYVDQACRAAEEFVNIYYETMDKRRRALTRLYLDKATLIWNGNVVTGLDSLSNFFEM
LPSSEFQVNMLDCQPVHEQATQSQTTVLVVTSGTVKFDGNKQHFFNQNFLLTAHSTPTST
VWKIASDCFRFQDWASC
NT seq 594 nt   +upstreamnt  +downstreamnt
atgagaaaattcagaagagactggtctcaggaagactatgaaaggcgtcaaggaaggagc
gactatcgtcatgaggagccacaaaccagctactcataccgaggaggccacagacgcgag
gaggtagtaacgccgccactggaccaaagtgcttcgggctcctcgatggccacgtccgtg
gatttcaaaacttatgtggatcaagcctgcagagctgctgaggagtttgtgaacatttac
tacgagacaatggacaaaagaagacgggcacttaccaggctgtacctagacaaggccact
ttaatttggaatggaaatgttgtgaccgggctggattctctgagtaatttttttgagatg
ttgccatccagtgagtttcaagtcaacatgttggattgccagccagttcatgagcaagct
acccagtcccagacaacagttcttgttgtgaccagtggaactgtgaagttcgatggaaac
aagcaacacttcttcaaccaaaacttcctgctgaccgctcattccactcccaccagtaca
gtgtggaaaattgccagtgattgcttccgttttcaagactgggctagttgttaa

KEGG   Oryctolagus cuniculus (rabbit): 100351903
Entry
100351903         CDS       T03373                                 

Gene name
NXT1
Definition
(RefSeq) nuclear transport factor 2 like export factor 1
  KO
K14285  NTF2-related export protein 1/2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03008  Ribosome biogenesis in eukaryotes
ocu03013  RNA transport
ocu03015  mRNA surveillance pathway
ocu05014  Amyotrophic lateral sclerosis
ocu05164  Influenza A
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    100351903 (NXT1)
   03015 mRNA surveillance pathway
    100351903 (NXT1)
   03008 Ribosome biogenesis in eukaryotes
    100351903 (NXT1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100351903 (NXT1)
  09172 Infectious disease: viral
   05164 Influenza A
    100351903 (NXT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100351903 (NXT1)
   03009 Ribosome biogenesis [BR:ocu03009]
    100351903 (NXT1)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     100351903 (NXT1)
Ribosome biogenesis [BR:ocu03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    100351903 (NXT1)
SSDB
Motif
Pfam: NTF2 Cofilin_ADF DUF4518
Other DBs
NCBI-GeneID: 100351903
NCBI-ProteinID: XP_002710984
Ensembl: ENSOCUG00000025924
UniProt: G1U3H8
LinkDB
Position
4
AA seq 140 aa
MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGHESLSE
FFEMLPSSEFQISVVDCQPVHDEATPSQTTVLVVICGTVKFEGNKQRDFNQNFILTAQAS
PSNTVWKIASDCFRFQDWAN
NT seq 423 nt   +upstreamnt  +downstreamnt
atggcgtctgtggacttcaagacctacgtggaccaggcatgccgggcggccgaggagttc
gtcaacgtgtactacaccaccatggacaagcggcggcgactgctctcgcgcctgtacatg
ggcaccgccaccctcgtgtggaatggaaacgccgtctcaggacacgagtccctgagcgag
ttttttgagatgctgccttccagtgagttccagatcagcgtggtagactgccagcctgtg
cacgacgaagccacgccgagccagaccacggtgctcgtggtcatctgtgggacggtgaag
ttcgagggcaacaaacagcgggacttcaaccagaacttcatcctcaccgcgcaggcctca
cccagcaacaccgtgtggaagatcgccagtgactgcttccgcttccaggactgggccaac
tag

DBGET integrated database retrieval system