KEGG   Oryctolagus cuniculus (rabbit): 100340139
Entry
100340139         CDS       T03373                                 

Gene name
PLCG2
Definition
(RefSeq) phospholipase C gamma 2
  KO
K05859  phosphatidylinositol phospholipase C, gamma-2 [EC:3.1.4.11]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00562  Inositol phosphate metabolism
ocu01100  Metabolic pathways
ocu01521  EGFR tyrosine kinase inhibitor resistance
ocu04012  ErbB signaling pathway
ocu04014  Ras signaling pathway
ocu04020  Calcium signaling pathway
ocu04062  Chemokine signaling pathway
ocu04064  NF-kappa B signaling pathway
ocu04066  HIF-1 signaling pathway
ocu04070  Phosphatidylinositol signaling system
ocu04072  Phospholipase D signaling pathway
ocu04360  Axon guidance
ocu04370  VEGF signaling pathway
ocu04380  Osteoclast differentiation
ocu04611  Platelet activation
ocu04613  Neutrophil extracellular trap formation
ocu04625  C-type lectin receptor signaling pathway
ocu04650  Natural killer cell mediated cytotoxicity
ocu04662  B cell receptor signaling pathway
ocu04664  Fc epsilon RI signaling pathway
ocu04666  Fc gamma R-mediated phagocytosis
ocu04670  Leukocyte transendothelial migration
ocu04722  Neurotrophin signaling pathway
ocu04750  Inflammatory mediator regulation of TRP channels
ocu04919  Thyroid hormone signaling pathway
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu04935  Growth hormone synthesis, secretion and action
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05171  Coronavirus disease - COVID-19
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05206  MicroRNAs in cancer
ocu05214  Glioma
ocu05223  Non-small cell lung cancer
ocu05225  Hepatocellular carcinoma
Module
ocu_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100340139 (PLCG2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100340139 (PLCG2)
   04014 Ras signaling pathway
    100340139 (PLCG2)
   04370 VEGF signaling pathway
    100340139 (PLCG2)
   04064 NF-kappa B signaling pathway
    100340139 (PLCG2)
   04066 HIF-1 signaling pathway
    100340139 (PLCG2)
   04020 Calcium signaling pathway
    100340139 (PLCG2)
   04070 Phosphatidylinositol signaling system
    100340139 (PLCG2)
   04072 Phospholipase D signaling pathway
    100340139 (PLCG2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100340139 (PLCG2)
   04613 Neutrophil extracellular trap formation
    100340139 (PLCG2)
   04625 C-type lectin receptor signaling pathway
    100340139 (PLCG2)
   04650 Natural killer cell mediated cytotoxicity
    100340139 (PLCG2)
   04662 B cell receptor signaling pathway
    100340139 (PLCG2)
   04664 Fc epsilon RI signaling pathway
    100340139 (PLCG2)
   04666 Fc gamma R-mediated phagocytosis
    100340139 (PLCG2)
   04670 Leukocyte transendothelial migration
    100340139 (PLCG2)
   04062 Chemokine signaling pathway
    100340139 (PLCG2)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    100340139 (PLCG2)
   04919 Thyroid hormone signaling pathway
    100340139 (PLCG2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100340139 (PLCG2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100340139 (PLCG2)
  09158 Development and regeneration
   04360 Axon guidance
    100340139 (PLCG2)
   04380 Osteoclast differentiation
    100340139 (PLCG2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100340139 (PLCG2)
   05206 MicroRNAs in cancer
    100340139 (PLCG2)
   05205 Proteoglycans in cancer
    100340139 (PLCG2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100340139 (PLCG2)
   05214 Glioma
    100340139 (PLCG2)
   05223 Non-small cell lung cancer
    100340139 (PLCG2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100340139 (PLCG2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100340139 (PLCG2)
   05171 Coronavirus disease - COVID-19
    100340139 (PLCG2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100340139 (PLCG2)
   05169 Epstein-Barr virus infection
    100340139 (PLCG2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100340139 (PLCG2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100340139 (PLCG2)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100340139 (PLCG2)
Membrane trafficking [BR:ocu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100340139 (PLCG2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100340139 (PLCG2)
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y SH3_1 C2 SH3_9 PH SH3_2 PH_12 PH_14 GDPD EF-hand_like
Other DBs
NCBI-GeneID: 100340139
NCBI-ProteinID: XP_002711703
Ensembl: ENSOCUG00000013105
UniProt: G1T4R9
LinkDB
Position
5
AA seq 1267 aa
MAMPTMVNVEALPEYEKSQIKRALELGTVMTVFSFRKCTPERRTVQVIMETRQVAWSKTA
DKIEGFLDIMDIKEIRPGKNSKDFERAKAVRQKEDCCFTLLYGTQFVLSTLSLAADSKED
AIKWLSGLKILHQEVMSASTPTIIESWLRKQIYSVDQTRRNSISLRELKTILPLLNFKAS
SAKFLKDKFVEIGTQKDELSFEQFHLFYKKLMFEHQRSILDEFKKDSSVFILGNTDRPDA
SAVHLHDFQRFLLHEQQELWAQDLNKVRERMTKFIDDTMRETAEPFLFVDEFLTYLFSRE
NSIWDEKYDVVDMQDMNNPLSHYWISSSHNTYLTGDQLRSESSTEAYIRCLRLGCRCIEL
DCWDGPDGKPIIYHGWTRTTKIKFDDVVQAIKDHAFVTSSFPVILSIEEHCSVEQQRHMA
RVFKEVLGDLLLTKPTEASADQLPSPSQLREKIIIKHKKLGPRGDVDVNMEDKKDEHKQQ
GELYMWDSIDQKWTRHYCAIADAKLSFSDDIEQAVEEEPPQDTPPTELHFGEKWFHKKVE
KRMSAEKLLQDYCAETGGKDGTFLVRESETYPDKYTLSFWRSGRVQHCLIRSTVEGGTTK
YYLTDNLKFTSIYALIQHYREAHLRCTEFELQLTDPVPNPNPHESKPWFYDALSRGEAED
MLMRIPRDGAFLIRRREGSDSYAITFRARGKVKHCRINRDGRHFVLGTSAYFESLVELVS
YYEKHTLYRKMRLRYPVTPELLERYSMERDINSLYDVSRMYVDPSEINPSMPQRTVKALY
DYKAKQSDELSFCRGALIHNVSKEPGGWWKGDYGTRIQQYFPSNYVEDISTVDVEELEKQ
IIEDNPLGTLCRGILDLNSYNVVKAPQGKNQKSFVFILEPKKQGDPPVEFATDRVEELFE
WFQSIRQINWKMDTKENNMRYWEKNQSIAIELSDLVVYCKPTSKTKDNLENPDFREIRSF
VETKADSIVRQKPIDLLRYNQKGLTRVYPKGQRVDSSNYDPFRLWLCGSQMVALNFQTAD
KYMQMNHALFSLNGRTGYVLQPESMRTEKYDPMPPEAQRRILMTVTVKVLGARHLPKLGR
SIACPFVEVEICGAECDNNKFKTTVVNDNGLNPVWASTQEKVTFEIYDPNLAFLRFVVYE
EDMFSDPNFLAHATYPIKGIKSGFRSVPLKNGYSEDIELASLLVFCEIRPVLESEEELYS
SCRQLRRRQEELNNQLFLYDTHQNLRNANRDALIKEFNVNENQLQLYQERCNRRLREKRV
SNSKFYS
NT seq 3804 nt   +upstreamnt  +downstreamnt
atggcaatgcccaccatggtgaacgtggaggccctcccggaatacgagaagagccagatc
aagagagccctggagctgggcacggtgatgaccgtgttcagcttccgcaagtgcacccca
gagcggaggactgtccaggtgatcatggagacgcgccaggtggcctggagcaagacggct
gacaagatcgagggcttcttggatatcatggacataaaggaaatccgtccgggaaagaac
tccaaggatttcgagcgtgcgaaagcagtgcgccagaaagaagactgctgcttcaccctc
ctgtacggcacccagttcgttctcagcacactcagcttggcagctgactccaaagaggat
gccatcaagtggctctcgggcttgaaaatcttacaccaggaagtgatgagtgcgtccacg
cccaccatcattgagagctggctcaggaagcagatatactccgtggatcaaaccagaagg
aacagcatcagcctgcgcgagctgaagaccatcctaccgctgctcaacttcaaagccagc
agcgccaagttcctcaaggataagtttgtggaaataggcacacagaaggatgagctcagc
ttcgagcagttccatctcttctataagaaactgatgttcgaacaccaaagatcgattctc
gacgaattcaagaaggattcctccgtgttcatcctggggaacaccgaccggccggacgcc
tctgccgttcacctgcacgacttccagaggtttctcttgcacgaacagcaggagctctgg
gcccaggatctgaacaaagtgcgtgagcggatgacgaagtttatcgacgacaccatgagg
gagacggccgagcccttcttgttcgtggatgagttcctcacgtacctgttctcgcgagaa
aacagcatctgggacgagaagtacgacgtggtggacatgcaggacatgaacaaccccttg
tctcattactggatctcctcctcccacaacacgtacctcactggggaccagctgcggagc
gagtcctccacggaggcgtacatccgctgcctgcgcctgggctgccgctgcatcgagctg
gactgctgggacgggcccgacgggaagcccatcatctaccacggctggacacggaccacc
aagatcaagttcgacgacgtcgtgcaggccatcaaagaccacgcctttgtcacctcaagc
ttcccggtgatcttgtccatcgaggagcactgcagtgtggagcagcagcgccacatggcc
agggtgttcaaggaggtgctgggcgacctgctgctcaccaagcccacggaggccagtgct
gaccagctgccgtcacccagccagctgcgggaaaagatcattatcaagcacaagaagctg
ggtcctcgaggtgacgtggacgtcaacatggaggacaagaaagacgaacacaagcagcag
ggtgaactgtacatgtgggactccatcgaccagaagtggacgcgacattactgtgccatc
gccgatgccaagctgtctttcagtgacgacatagagcaggcggtggaggaagagccgccc
caggatacgccccccacagagctgcattttggggagaaatggtttcacaagaaagttgag
aagcggatgagcgccgagaagcttctgcaagactactgcgccgagacagggggcaaggat
ggcacattcctggtgcgcgagagcgagacctacccggacaagtacaccctgtccttttgg
cgatccggccgtgtccagcactgcttgatccgctccaccgtggagggcggcaccacgaag
tactacctgactgacaacctcaagttcaccagcatctatgccctcatccagcactaccgc
gaggcgcacctgcgctgcaccgagttcgagctgcagctcaccgaccccgtgcccaacccc
aaccctcacgagtcgaagccgtggttctacgatgcgctgagccgcggggaagccgaggac
atgctcatgcggatcccgcgggacggcgcgttcctgatccgcaggcgggaaggaagcgac
tcctacgccatcaccttcagggccaggggcaaggtgaagcactgtcgcatcaaccgcgat
ggccggcacttcgtgctggggacctctgcctacttcgagagcctcgtggagctcgtcagc
tactacgagaagcacacgctgtaccggaagatgaggctgcggtaccccgtgacgcccgag
ctgctggagcgctacagcatggagagagacataaactccctgtatgacgtcagtaggatg
tacgtggatccgagtgagatcaacccttccatgcctcagagaaccgtgaaagctctctat
gactacaaagccaagcagagtgacgagctgagcttctgccgcggtgccctgatccacaac
gtctccaaggagcccggtggctggtggaaaggagactacgggaccagaatccagcagtac
tttccgtccaactacgtcgaggacatctccacagtggacgtggaggagctggaaaagcag
attatcgaagacaaccccttaggcactctctgtagaggaatcctggacctcaactcctat
aacgtggtgaaagccccacagggcaaaaaccagaagtctttcgtgtttatcctggagccc
aagaagcagggggatcctccagtggagttcgccacggacagggtggaagagctcttcgag
tggttccagagcatccggcagatcaactggaagatggacaccaaggagaacaacatgaga
tactgggagaagaaccagtccatcgccattgagctctccgacctggttgtctactgcaag
cccaccagcaagaccaaggacaacctagagaaccccgacttccgggaaatccgctccttt
gtggagacgaaggctgacagcatcgtcagacagaagcccatcgaccttctgcgctacaac
cagaagggcctgacccgtgtctacccgaagggacagcgggtcgactcctccaactacgac
cccttccgcctgtggctgtgcggctcccagatggtggcgctcaatttccagacggcagac
aagtacatgcagatgaaccacgcgctgttctcactcaacgggcggacgggctacgtcctg
cagcccgagagcatgcggaccgagaagtacgacccgatgccgcccgaggcgcagaggagg
atcctgatgaccgtcacggtcaaggtcctgggcgcgcgccatctccccaagctgggccgg
agcatcgcctgtccctttgtggaggtagaaatctgtggagccgagtgcgacaacaacaaa
tttaagacgacggtcgtgaatgataacggcctcaacccagtctgggcgtcgacccaggag
aaggtgacatttgagatttacgaccccaacctggcgtttctgcgctttgtggtttatgag
gaagacatgttcagtgaccccaacttcctcgcgcacgccacctaccccatcaaaggcatc
aagtcaggcttccgatctgttccgctgaagaacgggtacagcgaggacatcgaactggcg
tccctcttggttttctgtgagatacgacccgtcctggagagtgaagaagaactgtattcc
tcctgtcgccagctgcggaggcggcaagaagagcttaacaaccaactcttcctctatgac
acacaccagaacttgcgcaatgccaaccgggacgccctcattaaagagttcaatgtcaac
gaaaaccagctccagctgtaccaggagaggtgcaaccggaggttacgagagaaacgagtc
agcaacagcaagttttactcttag

KEGG   Oryctolagus cuniculus (rabbit): 100349958
Entry
100349958         CDS       T03373                                 

Gene name
PLCG1
Definition
(RefSeq) phospholipase C gamma 1
  KO
K01116  phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00562  Inositol phosphate metabolism
ocu01100  Metabolic pathways
ocu01521  EGFR tyrosine kinase inhibitor resistance
ocu04012  ErbB signaling pathway
ocu04014  Ras signaling pathway
ocu04015  Rap1 signaling pathway
ocu04020  Calcium signaling pathway
ocu04062  Chemokine signaling pathway
ocu04064  NF-kappa B signaling pathway
ocu04066  HIF-1 signaling pathway
ocu04070  Phosphatidylinositol signaling system
ocu04072  Phospholipase D signaling pathway
ocu04360  Axon guidance
ocu04370  VEGF signaling pathway
ocu04613  Neutrophil extracellular trap formation
ocu04650  Natural killer cell mediated cytotoxicity
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu04660  T cell receptor signaling pathway
ocu04664  Fc epsilon RI signaling pathway
ocu04666  Fc gamma R-mediated phagocytosis
ocu04670  Leukocyte transendothelial migration
ocu04722  Neurotrophin signaling pathway
ocu04750  Inflammatory mediator regulation of TRP channels
ocu04919  Thyroid hormone signaling pathway
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu04935  Growth hormone synthesis, secretion and action
ocu05012  Parkinson disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05135  Yersinia infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05171  Coronavirus disease - COVID-19
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05206  MicroRNAs in cancer
ocu05214  Glioma
ocu05223  Non-small cell lung cancer
ocu05225  Hepatocellular carcinoma
ocu05231  Choline metabolism in cancer
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Module
ocu_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100349958 (PLCG1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100349958 (PLCG1)
   04014 Ras signaling pathway
    100349958 (PLCG1)
   04015 Rap1 signaling pathway
    100349958 (PLCG1)
   04370 VEGF signaling pathway
    100349958 (PLCG1)
   04064 NF-kappa B signaling pathway
    100349958 (PLCG1)
   04066 HIF-1 signaling pathway
    100349958 (PLCG1)
   04020 Calcium signaling pathway
    100349958 (PLCG1)
   04070 Phosphatidylinositol signaling system
    100349958 (PLCG1)
   04072 Phospholipase D signaling pathway
    100349958 (PLCG1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100349958 (PLCG1)
   04650 Natural killer cell mediated cytotoxicity
    100349958 (PLCG1)
   04660 T cell receptor signaling pathway
    100349958 (PLCG1)
   04658 Th1 and Th2 cell differentiation
    100349958 (PLCG1)
   04659 Th17 cell differentiation
    100349958 (PLCG1)
   04664 Fc epsilon RI signaling pathway
    100349958 (PLCG1)
   04666 Fc gamma R-mediated phagocytosis
    100349958 (PLCG1)
   04670 Leukocyte transendothelial migration
    100349958 (PLCG1)
   04062 Chemokine signaling pathway
    100349958 (PLCG1)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    100349958 (PLCG1)
   04919 Thyroid hormone signaling pathway
    100349958 (PLCG1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100349958 (PLCG1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100349958 (PLCG1)
  09158 Development and regeneration
   04360 Axon guidance
    100349958 (PLCG1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100349958 (PLCG1)
   05206 MicroRNAs in cancer
    100349958 (PLCG1)
   05205 Proteoglycans in cancer
    100349958 (PLCG1)
   05231 Choline metabolism in cancer
    100349958 (PLCG1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100349958 (PLCG1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100349958 (PLCG1)
   05214 Glioma
    100349958 (PLCG1)
   05223 Non-small cell lung cancer
    100349958 (PLCG1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100349958 (PLCG1)
   05022 Pathways of neurodegeneration - multiple diseases
    100349958 (PLCG1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100349958 (PLCG1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100349958 (PLCG1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100349958 (PLCG1)
   05171 Coronavirus disease - COVID-19
    100349958 (PLCG1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100349958 (PLCG1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100349958 (PLCG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100349958 (PLCG1)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100349958 (PLCG1)
Membrane trafficking [BR:ocu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100349958 (PLCG1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100349958 (PLCG1)
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y C2 SH3_1 PH SH3_9 SH3_2 PH_12 GDPD
Other DBs
NCBI-GeneID: 100349958
NCBI-ProteinID: XP_017206074
Ensembl: ENSOCUG00000008231
LinkDB
Position
Un
AA seq 1307 aa
MAGAASPCANSCCSSTPTEAEELHLCRSLEVGTVMTLFYSKKSQRPERKTFQVKLETRQI
TWSRGADKIEGAIDIREIKEIRPGKTSRDFDRYQEDPAFRPDQSHCFVILYGMEFRLKTL
SLQATSEDEVNMWIKGLTWLMEDTLQAATPLQIERWLRKQFYSVDRNREDRISAKDLKNM
LSQVNYRVPNMRFLKERLTDLEQRSGDITYGQFAQLYRSLMYSAQKTMDLPFLEASALRT
GERPDLCRVTLPEFQQFLLEYQGELWAIDRLQVQEFMLSFLRDPLREIEEPYFFLDEFVT
FLFSKENSVWNSQLDAVCPDTMNNPLSHYWISSSHNTYLTGDQFSSESSLEAYARCLRMG
CRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVLHTIKEHAFVASEYPVILSIEDHCSIA
QQRNMAQYFKKVLGDTLLTKPVDIAADGLPSPNQLKRKILIKHKKLAEGSAYEEVPTSVM
YSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPKEASG
STELHSNEKWFHGKLGAGRDGRHIAERLLTEYCIETGAPDGSFLVRESETFVGDYTLSFW
RNGKVQHCRIHSRQDAGTPKFFLTDNLVFDSLYDLITHYQQVPLRCNEFEMRLSEPVPQT
NAHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRSEPNSYAISFRAEGKIKHCRVQQE
GQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEEALEKIGTAEPDYGALYEGRNP
GFYVEANPMPTFKCAVKALFDYKAQREDELTFTKSAIIQNVEKQEGGWWRGDYGGKKQLW
FPSNYVEEMVSPAALEPEREHLDENSPLGDLLRGVLDVPACQIVFLPLVEDGTELGGNRT
QVRPEGKNNRLFLLSLSMASLAHWSLDXAADSQEELQDWVKKIREVAQTADARLTEGKMM
ERRKKIALELSELVVYCRPVPFDEEKIGTERACYRDMSSFPETKAEKYVNKAKGKKFLQY
NRLQLSRIYPKGQRLDSSNYDPLPMWICGSQLVALNFQTPDKPMQMNQALFMAGGHCGYV
LQPNTMRDEAFDPFDKSSLRGLEPCAICIEVLGARHLPKNGRGIVCPFVEIEVAGAEYDS
TKQKTEFVVDNGLNPMWPAKPFHFQISNPEFAFLRFVVYEEDMFSDQNFLAQATFPVKGL
KTGYRAVPLKNNYSEDLELASLLIKIDIFPAKENGDLSPFGSTSLRERGSDASGQLFHGR
AREGSFEARYQQPFEDFRISQEHLADHFDGRERRAPRRTRVNGDSRL
NT seq 3924 nt   +upstreamnt  +downstreamnt
atggcgggcgccgcgtccccttgcgccaatagctgctgctccagcacgcccacggaagcc
gaagagctgcacctctgccgcagcctcgaggtgggcaccgtcatgactttgttctactcc
aagaagtcgcagcggcccgagcggaagaccttccaggtcaaactggagacgcgccagatc
acgtggagccgcggcgccgacaagatcgagggggccattgacattcgtgaaatcaaggag
atccgcccaggaaagacctcacgggacttcgatcgctatcaagaggaccccgctttccgc
ccagaccagtcacactgctttgtcatcctctatgggatggaattccgcctgaagaccctg
agcttacaagcaacgtctgaggatgaagtgaatatgtggatcaagggcttaacttggctg
atggaggacacattgcaggcagctacacctctgcagattgagaggtggcttcggaaacag
ttttactcagtggatcggaatcgggaggatcgtatttcagccaaagacctgaagaacatg
ctgtcccaggtcaactaccgggtccccaacatgcgcttcctcaaggagcggctgacggac
ctggagcagcgcagtggggacatcacctacgggcagtttgctcagctgtaccgcagcctc
atgtacagcgcccagaagacgatggatctccccttcttggaagccagcgccctgaggaca
ggggagcgaccagatctttgccgagtgacccttcctgagttccagcagttcctccttgag
taccagggggagctatgggccattgaccggctccaggtacaggaattcatgctcagcttt
ctccgggaccccttgcgagagattgaggaaccatacttcttcctggatgagtttgtcacc
ttcctgttctccaaagagaacagtgtgtggaactcccagctggatgcagtgtgcccagac
accatgaacaaccctctctcccactattggatctcatcctcacacaacacgtacctgact
ggggaccagttctccagcgagtcctccctggaagcctatgctcggtgtctgcggatgggc
tgtcgctgcattgaattggactgctgggatggcccagatgggatgccagtcatttaccat
ggacacacccttaccaccaagatcaagttctcagatgtcctgcataccatcaaggaacat
gcctttgtggcctcagagtacccggtcatcctgtccatcgaggaccactgcagcattgcc
cagcagaggaacatggcccagtactttaagaaggtgctgggggacacgctcctcaccaag
cctgtggacattgctgccgatgggctgccctcacccaaccagctcaagaggaagatcctc
atcaagcacaagaagctggctgagggcagtgcctatgaggaagtgcccacctcggtgatg
tactctgagaatgacatcagcaactccatcaagaatggcatcctgtacttggaggatcct
gtgaaccacgagtggtatccccactactttgttctgaccagcagtaagatctattactct
gaagagaccagcagtgaccagggcaatgaagatgaggaggagcccaaggaggccagtggc
agcacagagctgcactccaatgagaagtggttccacgggaagcttggggcaggacgggac
gggcggcacatcgccgagcgcctgctcacggaatactgcatcgagactggcgcccccgac
ggctccttcctagttcgggagagcgagacctttgtgggcgactacacattgtctttctgg
cggaatgggaaagtccagcactgccgtatccactcccggcaggatgctgggacccccaag
ttcttcctgacagacaatctggtctttgactccctctatgatctcatcacacactaccag
caagtgcctctgcgctgcaatgagtttgagatgcgtctgtcagagcctgttccacagacc
aatgcccatgagagcaaagagtggtaccatgcaagcctgaccagagcacaggctgagcat
atgctgatgcgtgttccccgtgatggggccttcctggtgcgaaaacggagtgagcccaac
tcatatgccatctccttccgggctgagggcaagatcaagcattgccgtgtccagcaggag
ggccagacagtgatgctggggaactcggagtttgacagcctcgttgacctcatcagctac
tatgagaagcacccactgtaccgcaagatgaagctccgctatcctatcaatgaagaggcg
ttggagaagattggcacagctgaacctgactatggggccctgtatgagggccgaaaccct
ggcttttacgtggaggcaaaccctatgccgactttcaagtgtgcagtcaaagccctcttt
gactacaaggcgcagagagaggatgagctgaccttcaccaagagcgctatcatccagaat
gtagagaagcaagaaggaggctggtggcgaggagactatggcggaaaaaagcagctgtgg
ttcccttcaaactatgtggaagagatggtcagtccagcggccctggagcctgaaagggag
cacttggacgagaacagccccctgggggacttgctgcggggggtcttggatgtgccggct
tgtcagattgtgttcctccccctcgtggaggatggtacagaactgggaggcaacagaacc
caagtccgtcctgagggcaagaacaaccggctcttcctgttatcgctcagcatggcctcg
ctggcccactggtccctggatngtgctgccgactcacaggaggagctacaggactgggtg
aaaaagatccgtgaggtggcccagactgcagatgccaggctcaccgaggggaagatgatg
gaacggaggaagaagatcgcgctggaactgtctgagcttgtcgtctactgccggcctgtt
cccttcgatgaagagaaaatcggcacagagcgagcttgctatcgggacatgtcatccttc
ccggaaaccaaggctgagaaatatgtgaacaaggccaaaggcaagaagttcctccagtac
aaccgtctgcaactctcccgcatctaccccaagggccagagactagactcctctaattat
gaccctttgcccatgtggatctgtggcagtcagctggtggccctcaacttccagacccca
gataagcctatgcagatgaaccaggccctcttcatggctggtgggcactgtggctacgtg
ctgcagcccaacaccatgcgggatgaggccttcgatccattcgacaagagcagcctccgg
gggctagagccgtgtgccatctgcattgaggtgctgggggctcggcatctgccgaagaat
ggccgaggcattgtgtgtcctttcgtggagattgaggtggctggagcagagtatgacagt
accaagcagaagacagaatttgtggtggacaatggactgaacccgatgtggcccgccaag
cccttccacttccagatcagcaaccctgaatttgccttcctgcgctttgtggtatatgaa
gaagacatgttcagtgaccagaacttcctggctcaggctactttcccagtgaaaggcctg
aagacaggatacagagcagtgcctttgaagaacaactacagtgaggacctggagttggcc
tctctgctcatcaagatcgacattttccctgccaaggagaatggtgacctcagtcccttt
ggtagcacgtctctgcgggaacggggttcagatgcctcaggccagctgtttcacggcaga
gcccgagaaggttcttttgaagcccgctaccagcagccgtttgaggacttccgcatttcc
caggagcatcttgcagaccattttgatggtcgagaacgaagggccccaaggaggactcgg
gtcaatggagacagccgcctctag

DBGET integrated database retrieval system