KEGG   Oryctolagus cuniculus (rabbit): 100340242
Entry
100340242         CDS       T03373                                 

Gene name
RNGTT
Definition
(RefSeq) RNA guanylyltransferase and 5'-phosphatase
  KO
K13917  mRNA-capping enzyme [EC:2.7.7.50 3.6.1.-]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100340242 (RNGTT)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100340242 (RNGTT)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.50  mRNA guanylyltransferase
     100340242 (RNGTT)
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-  
     100340242 (RNGTT)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA processing factors
   5' end processing
    Capping factors
     100340242 (RNGTT)
SSDB
Motif
Pfam: mRNA_cap_enzyme mRNA_cap_C DSPc DNA_ligase_A_M Y_phosphatase Y_phosphatase2
Other DBs
NCBI-GeneID: 100340242
NCBI-ProteinID: XP_002714620
Ensembl: ENSOCUG00000017081
UniProt: G1TCZ1
LinkDB
Position
12
AA seq 597 aa
MAQNKIPPRWLNCPRRGQPVAGRFLPLKTMLGPRYDSQVAEENRFHPSMLSNYLKSLKVK
MGLLVDLTNTSRFYDRNDIEKEGIKYIKLQCKGHGECPTTEVTNTFIRLCERFNDRNPPE
LIGVHCTHGFNRTGFLICAFLVEKMDWSIEAAVATFAQARPPGIYKEDYLKELFRRYGDI
EEAPPPPLLPDWCFEDDEDEDEEEDGKKESEPGSSTSFGKRRKERLKLGAIFLEGITVKG
VTQVTTQPKLGEVQQKCHQFCGWEGSGFPGAQPVSMDKQNIRLLEQKPYKVSWKADGTRY
MMLIDGTNEVFMIDRDNSVFHVSNLEFPFRKDLRMHLSNTLLDGEMIIDRVNGQAVPRYL
IYDIIKFNAQPVGDCDFNIRLQCIEREIINPRHEKMKTGLIDKTQEPFSVRNKPFFDIHT
SRKLLEGNFAKEVSHEMDGLIFQPIGKYKPGRCDDILKWKPPSLNSVDFRLKITRMGGEG
LLPQNVGLLYVGGYERPFAQIKVTKELKQYDNKIIECKFENNSWVFMRQRTDKSFPNAYN
TAMAVCNSISNPVTKEMLFEFIDRCAAASQGLKRKHHLDPDAELMPPPPPKRPRPLT
NT seq 1794 nt   +upstreamnt  +downstreamnt
atggctcaaaacaagatcccaccgcggtggctgaactgtcctcggcgcggccagccggtt
gcaggaagattcttacctctgaagacaatgttaggaccaagatatgatagtcaagttgct
gaagaaaatcgattccatccaagtatgctctcaaattatctaaagagtctaaaggttaaa
atgggcttgttggtagacctgacaaatacttcaaggttttatgatagaaatgacatagaa
aaagaaggaatcaaatatataaaacttcagtgtaaaggacatggtgagtgccctacaact
gaggttactaatacatttattcgtctgtgtgagcggtttaatgacagaaatccacctgaa
cttatcggcgttcattgcacccatggtttcaatcgtactggcttcctcatatgtgccttt
ttggtggagaaaatggattggagtatcgaagcagcagttgctacttttgcccaagccaga
ccaccaggaatctataaggaggattatttgaaggaactttttcgtcgttatggtgatata
gaagaagcaccacccccacctctattgccagattggtgttttgaagatgatgaagatgaa
gatgaggaagaggatggaaaaaaggaatcggaacctgggtcgagtacttcctttggcaaa
aggagaaaagaacggttaaaactgggtgctattttcttggaaggtataactgtgaaaggt
gtaactcaagtaacaactcaaccaaagctaggagaggtacagcagaagtgtcatcaattc
tgtggctgggaagggtctggattccctggagcacagcccgtttccatggacaagcaaaat
attagacttttagagcagaagccatataaagtaagctggaaagcagatggtactcgttat
atgatgttgattgatggcacaaatgaagtttttatgattgatagagacaattcagtgttt
catgtttcaaatctggaatttccatttcgtaaagatcttcgtatgcatttatcaaacact
cttttggatggggagatgattattgacagagtaaatggacaggctgttcctagatatttg
atatatgacatcattaaattcaatgcacagccagttggagattgtgattttaatatccgt
ctgcagtgtatagaacgagaaattataaatcctagacatgaaaaaatgaagactgggctc
attgacaaaacacaggaaccatttagtgtcagaaataagccattttttgacattcatact
tcaagaaagctacttgaaggaaattttgccaaagaagtcagtcatgaaatggatggactt
atatttcagcctatcgggaaatataaacctggccgatgtgatgatattttgaagtggaaa
cctcctagtctgaattctgtggattttcgcctgaagataacaagaatgggaggagaaggg
ttacttcctcagaatgttggccttctgtatgttggaggttatgaaagaccctttgcacaa
attaaggtgacaaaagagctaaaacagtatgacaacaaaattatagaatgcaaatttgag
aataacagctgggtcttcatgagacagagaacagacaaaagttttcctaacgcctataac
actgccatggccgtgtgcaatagcatctcaaaccctgtcaccaaggagatgctgttcgag
ttcattgacagatgtgctgcagcttctcaaggactgaagcgaaagcatcatctggacccc
gacgcggagctcatgccaccaccgcctcccaaaagaccgcggcctttgacctaa

DBGET integrated database retrieval system