KEGG   Oryctolagus cuniculus (rabbit): 100340389
Entry
100340389         CDS       T03373                                 

Gene name
MDM2
Definition
(RefSeq) MDM2 proto-oncogene
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01522  Endocrine resistance
ocu01524  Platinum drug resistance
ocu04068  FoxO signaling pathway
ocu04110  Cell cycle
ocu04115  p53 signaling pathway
ocu04120  Ubiquitin mediated proteolysis
ocu04144  Endocytosis
ocu04151  PI3K-Akt signaling pathway
ocu04218  Cellular senescence
ocu04625  C-type lectin receptor signaling pathway
ocu04919  Thyroid hormone signaling pathway
ocu05163  Human cytomegalovirus infection
ocu05165  Human papillomavirus infection
ocu05169  Epstein-Barr virus infection
ocu05200  Pathways in cancer
ocu05202  Transcriptional misregulation in cancer
ocu05203  Viral carcinogenesis
ocu05205  Proteoglycans in cancer
ocu05206  MicroRNAs in cancer
ocu05214  Glioma
ocu05215  Prostate cancer
ocu05218  Melanoma
ocu05219  Bladder cancer
ocu05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100340389 (MDM2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100340389 (MDM2)
   04151 PI3K-Akt signaling pathway
    100340389 (MDM2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100340389 (MDM2)
  09143 Cell growth and death
   04110 Cell cycle
    100340389 (MDM2)
   04115 p53 signaling pathway
    100340389 (MDM2)
   04218 Cellular senescence
    100340389 (MDM2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100340389 (MDM2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100340389 (MDM2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100340389 (MDM2)
   05202 Transcriptional misregulation in cancer
    100340389 (MDM2)
   05206 MicroRNAs in cancer
    100340389 (MDM2)
   05205 Proteoglycans in cancer
    100340389 (MDM2)
   05203 Viral carcinogenesis
    100340389 (MDM2)
  09162 Cancer: specific types
   05214 Glioma
    100340389 (MDM2)
   05220 Chronic myeloid leukemia
    100340389 (MDM2)
   05218 Melanoma
    100340389 (MDM2)
   05219 Bladder cancer
    100340389 (MDM2)
   05215 Prostate cancer
    100340389 (MDM2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100340389 (MDM2)
   05169 Epstein-Barr virus infection
    100340389 (MDM2)
   05165 Human papillomavirus infection
    100340389 (MDM2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100340389 (MDM2)
   01522 Endocrine resistance
    100340389 (MDM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100340389 (MDM2)
   04121 Ubiquitin system [BR:ocu04121]
    100340389 (MDM2)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100340389 (MDM2)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    100340389 (MDM2)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    100340389 (MDM2)
SSDB
Motif
Pfam: zf-C3HC4_3 SWIB zf-RanBP zf-RING_2 zf-FPG_IleRS
Other DBs
NCBI-GeneID: 100340389
NCBI-ProteinID: XP_017197461
LinkDB
Position
4
AA seq 490 aa
MCNTNMSVSTDGAVSTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVIFYLGQY
IMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQEPSDSST
SVSENRCHLEGGNDQKDPDQELQEEKPSSSSLVSRPSTSSRRRAISETEENSDELSERQR
KRHKSDSISLSFDESLALCVIREICCERSSSSESTETPSNLDLDDGVSEHSGDWLDQDSV
SDQFSVEFEVESLDSEDYSLSEEGQELSDEDDEVYRVTVYQAGESDTDSFEEDPEISLAD
YWKCTSCNEMNPPLPPHCNRCWALRENWLPEDKGKDKGGIPEKAKLENSTHAEEGFDVPD
CKKTTADDSQEACVEENDDKSTQASQSQESEDFSQPSTSNSIIYSSQEDVKEFEREETQD
KEESTESNIPLNAIEPCVICQGRPKNGCIVHGKTGHLMSCFTCAKKLKKRNKPCPVCRQP
IQMIVLTYFN
NT seq 1473 nt   +upstreamnt  +downstreamnt
atgtgcaataccaacatgtctgtgtctactgacggtgctgtaagcacctcacagattcca
gcttcggaacaagagaccctggttagaccaaagccattacttttgaagttgttaaagtct
gttggtgcacaaaaagacacttataccatgaaagaggttatattttatcttggccagtac
attatgactaaacgattgtatgatgagaagcaacaacatattgtgtattgttcaaatgat
cttcttggagatttgtttggagtgccaagcttctctgtgaaagagcacaggaaaatatat
acaatgatctacagaaacttggtagtagtcaatcagcaggaaccatcagattcaagtaca
tctgtgagtgagaacaggtgtcaccttgaaggtgggaatgatcaaaaggaccctgatcag
gagctgcaggaagagaaaccttcgtcttcaagtttggtttctagaccatctacctcatcc
agaaggagagcaattagtgagacagaagaaaattcagatgaattatctgaacgccaaaga
aagcgccacaaatcagatagtatttccctgtcctttgatgaaagcctggctctgtgtgta
ataagggagatatgttgtgaaagaagcagtagcagtgaatcgacagagacgccatcaaac
ctggatcttgatgatggtgtaagtgaacattcaggtgactggctggatcaggattcagtt
tctgatcagtttagtgtagaatttgaagttgaatctctagattcagaagattatagcctt
agtgaagaaggacaagaactctcagatgaagatgatgaggtatatcgagttactgtgtat
caggcaggagagagtgatacagattcatttgaagaagatcctgaaatttccttagctgac
tattggaagtgtacttcatgcaatgaaatgaatcctccccttccaccacattgcaacaga
tgttgggccctccgtgagaattggcttcctgaagataagggaaaagacaaagggggaatc
cctgagaaagccaaactagaaaactcgacacacgcggaagaaggctttgatgttcctgat
tgtaaaaaaactacagcagatgattcccaagaagcctgtgttgaggaaaatgatgataaa
agcacacaagcctctcaatcacaagaaagtgaggacttctctcagccatcaacttctaat
agcattatttatagcagccaagaagatgtcaaagagtttgagagggaagaaacacaagac
aaagaagaaagtacagaatctaatattccccttaatgccattgaaccttgtgtgatctgc
cagggtcgacctaaaaatggttgcattgttcatggcaaaacaggacacctaatgtcatgt
ttcacttgtgccaaaaaactaaagaaaaggaataagccctgcccagtatgtagacaacca
attcaaatgattgtgctaacttatttcaactaa

DBGET integrated database retrieval system