KEGG   Oryctolagus cuniculus (rabbit): 100340498
Entry
100340498         CDS       T03373                                 

Gene name
MAP3K5
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 5
  KO
K04426  mitogen-activated protein kinase kinase kinase 5 [EC:2.7.11.25]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01524  Platinum drug resistance
ocu04010  MAPK signaling pathway
ocu04071  Sphingolipid signaling pathway
ocu04141  Protein processing in endoplasmic reticulum
ocu04210  Apoptosis
ocu04530  Tight junction
ocu04668  TNF signaling pathway
ocu04714  Thermogenesis
ocu04722  Neurotrophin signaling pathway
ocu04932  Non-alcoholic fatty liver disease
ocu05010  Alzheimer disease
ocu05012  Parkinson disease
ocu05014  Amyotrophic lateral sclerosis
ocu05016  Huntington disease
ocu05017  Spinocerebellar ataxia
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100340498 (MAP3K5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100340498 (MAP3K5)
   04668 TNF signaling pathway
    100340498 (MAP3K5)
   04071 Sphingolipid signaling pathway
    100340498 (MAP3K5)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100340498 (MAP3K5)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100340498 (MAP3K5)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100340498 (MAP3K5)
  09159 Environmental adaptation
   04714 Thermogenesis
    100340498 (MAP3K5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100340498 (MAP3K5)
   05012 Parkinson disease
    100340498 (MAP3K5)
   05014 Amyotrophic lateral sclerosis
    100340498 (MAP3K5)
   05016 Huntington disease
    100340498 (MAP3K5)
   05017 Spinocerebellar ataxia
    100340498 (MAP3K5)
   05022 Pathways of neurodegeneration - multiple diseases
    100340498 (MAP3K5)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100340498 (MAP3K5)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100340498 (MAP3K5)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100340498 (MAP3K5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100340498 (MAP3K5)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     100340498 (MAP3K5)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: STE group
  STE11 family
   100340498 (MAP3K5)
SSDB
Motif
Pfam: DUF4071 Pkinase ASK_PH PK_Tyr_Ser-Thr FPP Pkinase_fungal Kinase-like
Other DBs
NCBI-GeneID: 100340498
NCBI-ProteinID: XP_008261789
Ensembl: ENSOCUG00000015434
LinkDB
Position
12
AA seq 1375 aa
MSADAGEGITFSVPPFAASGFGSFPEGGSCRXGGAAAVAESEEKPIPPPPAGSFWNVESA
GAPGSAACPAAAPGSGASRCRGSSGSVAGRRTTVAYVINEASQGQLVVAESEALQSLREA
CEAVGATLETLHFGKLDFGETAVLDRFYNADIAVVEMSDAFRQPSLFYHLGVRESFSMAN
NIILYCDSNADSLQSLKEIICQKNTMCTGNYTFVPYMVTPHNKVYCCDSSLMKGLTELMQ
PNLELLLGPICLPLVDRFIRLLKVAQASSSQYFRESILSDIRKARNLYTGKELAAELARI
RQRVDNIEVLTADIVINLLLSYRDIQDYDSIVQLVETLEKLPTFDLASHHHVKFHYAFAL
NRRNLPGDRAKALDIMIPMVQSEGQVASDMYCLVGRIYKDMFLDSNFTDTESRDRGASWF
KKAFESEPTLQSGINYAVLLLAAGHQFESSFELRKVGVKISSLLGKKGNLENLQSYWEVG
FFLGASVLANDHMRVIQASEKLFKLKTPAWYLKSXVETILIYKHFVKLTTEQPVAKQELV
DFWMDFLVEATKTDVTVVRFPVLILEPTKIYQPSYLSINNEVEEKTISIWHVLPDDKKGI
HEWNFSAASVRGVSISKFEERCCFLYVLHNSDDFQIYFCTELHCKKFFEMVNTITEEKGR
GAEEGDCEGDSLEYDYEYDENGDRVVLGKGTYGIVYAGRDLSNQVRIAIKEIPERDSRYS
QPLHEEIALHKHLKHKNIVQYLGSFSENGFIKIFMEQVPGGSLSALLRSKWGPLKDNEQT
IGFYTKQILEGLKYLHDNQIVHRDIKGDNVLINTYSGVLKISDFGTSKRLAGINPCTETF
TGTLQYMAPEIIDKGPRGYGKAADIWSVGCTIIEMATGKPPFYELGEPQAAMFKVGMFKV
HPEIPESMSAEAKAFILKCFEPDPDKRACANDLLVDEFLKVSSKKKKTQPKLSALSAGSN
EYLRSISLPVPVLVEDTSSSSEYGSVSPDTELKADPFSFKTRAKSCGEKDVKGIRTLFLG
IPDENFEDHSAPPSPEEKDSGFFLLRKDSERRATLHRILTEDQDKIVRNLMESLAQGAEE
PKLKWEHITTLIASLREFVRSTDRKIIATTLSKLKLELDFDSHGISQVQVVLFGFQDAVN
KVLRNHNIKPHWMFALDSIIRKAVQTAITILVPELRPHFSLASESDTADPEDLDVEDDHE
EQPSNQTVRRPQAATEDAVATSGVSTLSSTVSHDSQSAHRSLTLQLGRMKIETNRLLEEL
VQKEKELQALLLRAIEEKDQEIKHLKLKSQPIDIPGLPACHLNSPGTDTKDSELTDWLRE
NGADEDTISRFLAEEYTLVDVLYSVTREDLKCLRLRGGMLCSLWKAIIDFREKHT
NT seq 4128 nt   +upstreamnt  +downstreamnt
atgagcgccgacgccggcgagggcatcactttctccgtgccgcccttcgccgcctcgggc
ttcggctccttccctgagggcggcagctgccggnnaggaggagccgcggcggtggccgag
agcgaggagaagccaattccgccgccgccggcaggcagcttctggaacgtggagagcgcc
ggcgccccgggcagcgccgcgtgtcccgcagccgcccccgggagcggcgcctcgcggtgc
cgcggcagctctgggagcgtggccggccggcggaccacggtggcgtacgtgatcaacgaa
gcgagccaggggcagctggtggtggcggagagcgaggccctgcagagcctgcgggaggcg
tgcgaggcggtgggcgccaccctggagacgctgcattttggcaaactggacttcggggag
acggcggtgctggaccggttttacaatgcagacattgctgtggtggagatgagcgatgcc
ttccggcagccctccttgttctaccaccttggggtgagagagagcttcagcatggccaac
aacatcatcctctactgtgacagcaacgcagactctctgcagtcgctcaaggaaattatt
tgccagaagaatactatgtgcactgggaactacacctttgtcccttacatggtgacacca
cacaacaaggtctactgctgtgacagcagcctcatgaagggcttgactgagctcatgcaa
cccaacttggagctgcttctcggacccatctgcttacctcttgtggatcgtttcattcga
cttttgaaggtggcacaggcaagttccagccaatatttccgtgaatctatactcagcgat
atcaggaaagctcgaaatttatacactggtaaagaattggcagctgaattggcaagaatt
cggcaacgagtagataatattgaagtcttgacagcagatattgtgatcaacctgttactt
tcctacagagatatccaggattatgattctattgtgcagctggtggaaactttagaaaaa
ttgccaacctttgatttggcctctcatcaccatgtgaagtttcattatgcatttgcactg
aacaggagaaatctccctggagatagagccaaagctcttgacattatgattcccatggtg
caaagtgaagggcaggttgcttcagacatgtattgcctagttggtcgaatctataaggat
atgttcttggactctaatttcacagatactgaaagtagagaccgtggagcttcttggttc
aaaaaggcatttgagtctgagccaacactgcagtcgggaattaattatgctgtcctcctc
ctggcagccggtcaccagtttgaatcttcctttgagcttcggaaagttggggtgaagata
agtagccttctcggtaaaaaaggaaacttggaaaatctccagagctactgggaagttggg
ttttttctaggggccagtgtcctggccaacgaccacatgcgagtcattcaagcatcagaa
aagctttttaaactgaagacaccagcatggtacctcaagtctnatgtagagacaattttg
atatataagcattttgtgaaactgaccacagagcagcctgtggccaagcaagagctcgtg
gacttttggatggatttcttggtggaggccacaaaaacagatgttactgttgttaggttt
ccagtattaatattagaaccaaccaaaatctaccagccttcttatttgtctatcaacaat
gaagtcgaagaaaaaacaatatctatctggcatgtacttcctgatgacaagaaaggcatt
cacgagtggaacttcagtgctgcttctgtcaggggagtgagtatttctaaatttgaagaa
cgatgctgctttctgtatgtgcttcacaattctgatgatttccaaatctatttctgtaca
gagcttcactgtaaaaagttttttgaaatggtgaacaccatcactgaggagaaggggaga
ggtgcagaggaaggggactgtgaaggtgactctctggagtatgactacgaatatgatgaa
aatggagacagagttgttttgggcaaaggcacctatggaatcgtctatgcaggtcgagac
ctgagcaaccaagtcagaattgctattaaggaaatcccagagagagatagcagatactct
cagcccctacatgaagaaatagcattgcataagcacctgaagcacaaaaatattgtccag
tatctgggctctttcagtgaaaacggttttattaaaatcttcatggagcaggtcccagga
ggaagtctttctgctcttcttcgttccaaatggggccccttaaaagacaatgagcaaaca
attggcttttatacaaagcaaatactagaaggattaaaatacctccatgacaatcaaata
gtacatcgggatataaagggtgacaacgtgttgattaacacctatagtggggtgctcaag
atctctgacttcggaacatcaaagaggcttgctggcattaacccgtgcactgaaactttc
actggtacccttcagtacatggcaccagaaatcatagacaagggacctcgtggctacggg
aaggctgcagacatctggtctgtgggctgcacgatcatcgagatggccaccggaaagccc
ccgttttatgagctgggagaaccacaggcagctatgttcaaggtgggaatgtttaaagtc
caccccgagatcccggagtccatgtctgcagaggcgaaggcgttcatcctgaaatgtttt
gaaccagaccctgacaagagagcttgtgctaatgacttgcttgttgatgagttcttaaaa
gtttcaagcaaaaagaaaaagacacaacctaagctttcagctctttcagctggatcaaat
gagtatctcaggagcatctccttgccagtgcccgtcctggtggaggacacgagcagcagc
agcgagtacggctctgtttcccccgacactgagctaaaggcggaccccttctccttcaaa
accagagccaaatcctgcggcgagaaagatgtcaaaggaatacggaccctcttcctgggc
attccagatgagaacttcgaggaccacagcgcgcccccttcccccgaggagaaggactct
gggttcttcctgctgcggaaggacagcgagcgccgcgccacgctgcacaggatcctgact
gaagaccaagacaaaattgtgagaaacctgatggaatctctagctcagggggctgaagaa
cctaaactaaaatgggagcacatcacaactctcattgcaagcctcagagaatttgtgaga
tccactgaccgaaaaattatagccactacactgtctaagctgaaattagagctggacttc
gacagccatggtatcagccaagtccaggtggtgctctttggcttccaggatgctgtcaat
aaagttcttcggaatcataatatcaagccacactggatgttcgccttggacagtatcatc
cgaaaggcagtacagacagctattaccattcttgttccagaactaaggccacattttagc
cttgcatctgaaagtgacactgctgacccagaggacttggatgtagaagatgaccacgag
gaacagccatcaaatcaaactgtccgaagaccacaggctgccactgaagatgctgtggct
acctcaggggtgagcacgctcagctctactgtgtcccacgattcccagagcgctcaccga
tcactcaccttgcagcttggaaggatgaaaatagaaacaaatagattactggaagaattg
gttcagaaagagaaagaattgcaagcactccttcttcgagccattgaagaaaaagaccag
gaaattaagcacctgaagcttaagtcccaaccaatagatattcctgggttgcctgcctgt
catctaaattctcctggcacagatactaaagattctgaacttactgactggctgagagaa
aacggagctgatgaagacactataagtcggtttttggctgaggagtatacactagtggat
gttctctactctgttacacgcgaagatttaaaatgcctgagactaaggggagggatgctg
tgctcactatggaaggccatcatcgacttccgagaaaaacacacttga

DBGET integrated database retrieval system