KEGG   Oryctolagus cuniculus (rabbit): 100340576
Entry
100340576         CDS       T03373                                 

Gene name
RNMT
Definition
(RefSeq) RNA guanine-7 methyltransferase
  KO
K00565  mRNA (guanine-N7-)-methyltransferase [EC:2.1.1.56]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100340576 (RNMT)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100340576 (RNMT)
Enzymes [BR:ocu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.56  mRNA (guanine-N7)-methyltransferase
     100340576 (RNMT)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA processing factors
   5' end processing
    Capping factors
     100340576 (RNMT)
SSDB
Motif
Pfam: Pox_MCEL Methyltransf_25 Methyltransf_31 Methyltransf_11 Methyltransf_23 Methyltransf_12 Methyltransf_32 MTS
Other DBs
NCBI-GeneID: 100340576
NCBI-ProteinID: XP_002713518
Ensembl: ENSOCUG00000005610
UniProt: G1SPB2
LinkDB
Position
9
AA seq 475 aa
MENSTNIEECEKLPLEQAESSVNSEPESSLSAGENSTASGTGLSEKTLTCEQIDTSKKRK
ECEDDLVKESSSCEEDTPSKKRKLDAEIAPEQKGSGDDENISKKRKTGTDDDTHEPCPGD
GARKKRKLELEDVPEKQKNLEHGHGSAVAAHYNELQEVGLEKRSQSRIFYLRNFNNWIKS
ALIGEFLEKTRQKKKREIAVLDLGCGKGGDLLKWKKGRIHKLVCTDIADVSVKQCQQRYE
DMKSRRDGESLFNAEFITADCSKELLIEKLRDPEMHFDICSCQFVCHYSFESYKQADMLL
RNACERLSPGGYFIGTTPNSFELIKRLETSETESFGNEIYTVKFQKKGDYPLFGCKYDFN
LEGVVDVPEFLVYFPLLNEMVKKYNMKLVYKKTFLEFYEEKIKNNENKMLLKRMQALEPY
PANENSKPASEKVDDYSHAAEYMEKSQVRLPLGTLSKSEWEAASIYLVFAFEKQQ
NT seq 1428 nt   +upstreamnt  +downstreamnt
atggaaaattctacaaacatagaggaatgtgaaaagctgcctcttgaacaggcagaatct
tcagtaaattctgaaccagaatcttcccttagtgctggtgaaaactcaacagcttctggc
actgggctttctgaaaagactcttacctgtgagcagatagacacatcaaaaaagagaaaa
gagtgtgaagatgatcttgtaaaggaaagctccagttgtgaggaagacactccttccaag
aaaagaaaacttgatgctgaaattgctccagagcagaaaggttctggtgacgatgaaaac
atttcaaagaaaagaaaaacggggactgatgatgatacacatgaaccttgccctggagat
ggtgctcggaaaaagagaaaactagaacttgaagatgttcctgaaaagcagaagaaccta
gagcatggacatggctcagcagtagctgcccactataatgaacttcaggaagttggtttg
gagaagcgtagtcaaagtcgtatattttacctaagaaactttaataattggataaaaagt
gctctcattggggaatttttagaaaagactcgacagaaaaaaaaacgtgaaattgctgtt
ttggacctgggctgtggtaaaggtggagatttgctcaagtggaaaaagggaagaattcac
aagcttgtatgtactgatattgctgacgtttctgtcaaacaatgtcagcagcgttatgag
gacatgaagagtcgtcgtgatggtgaatctcttttcaatgcagaatttattactgctgac
tgttcaaaggaacttttgattgagaaacttcgtgatccagaaatgcactttgacatctgc
agttgtcaatttgtctgtcattactcatttgagtcctacaagcaggctgacatgttgctt
agaaatgcttgtgagaggcttagccctggaggctattttattggtaccactcctaatagc
tttgaactgataaaacgccttgaaacatcagaaacagaatcatttggaaatgaaatatat
acggtgaaatttcagaagaaaggagattatcccttatttggctgcaaatatgacttcaac
ttggaaggtgttgtggatgtccctgaattcttggtctattttccattgctaaatgaaatg
gtgaagaagtataatatgaagctagtctacaaaaaaacatttctggaattttatgaagaa
aagattaagaacaatgaaaataaaatgctgttgaaacgaatgcaggctctagagccgtat
cctgcaaatgagaattctaagcctgcttctgagaaggtggatgactacagccatgctgca
gaatacatggagaagagtcaagtgaggttacctttgggaaccttaagtaaatcagaatgg
gaagctgcaagtatttacctggtttttgccttcgagaagcagcagtga

DBGET integrated database retrieval system