KEGG   Oryctolagus cuniculus (rabbit): 100340619
Entry
100340619         CDS       T03373                                 

Gene name
CREBBP
Definition
(RefSeq) CREB binding protein
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04024  cAMP signaling pathway
ocu04066  HIF-1 signaling pathway
ocu04068  FoxO signaling pathway
ocu04110  Cell cycle
ocu04310  Wnt signaling pathway
ocu04330  Notch signaling pathway
ocu04350  TGF-beta signaling pathway
ocu04520  Adherens junction
ocu04630  JAK-STAT signaling pathway
ocu04720  Long-term potentiation
ocu04916  Melanogenesis
ocu04919  Thyroid hormone signaling pathway
ocu04922  Glucagon signaling pathway
ocu04935  Growth hormone synthesis, secretion and action
ocu05016  Huntington disease
ocu05152  Tuberculosis
ocu05161  Hepatitis B
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05200  Pathways in cancer
ocu05203  Viral carcinogenesis
ocu05206  MicroRNAs in cancer
ocu05211  Renal cell carcinoma
ocu05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100340619 (CREBBP)
   04330 Notch signaling pathway
    100340619 (CREBBP)
   04350 TGF-beta signaling pathway
    100340619 (CREBBP)
   04630 JAK-STAT signaling pathway
    100340619 (CREBBP)
   04066 HIF-1 signaling pathway
    100340619 (CREBBP)
   04068 FoxO signaling pathway
    100340619 (CREBBP)
   04024 cAMP signaling pathway
    100340619 (CREBBP)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100340619 (CREBBP)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100340619 (CREBBP)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100340619 (CREBBP)
   04935 Growth hormone synthesis, secretion and action
    100340619 (CREBBP)
   04919 Thyroid hormone signaling pathway
    100340619 (CREBBP)
   04916 Melanogenesis
    100340619 (CREBBP)
  09156 Nervous system
   04720 Long-term potentiation
    100340619 (CREBBP)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100340619 (CREBBP)
   05206 MicroRNAs in cancer
    100340619 (CREBBP)
   05203 Viral carcinogenesis
    100340619 (CREBBP)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100340619 (CREBBP)
   05215 Prostate cancer
    100340619 (CREBBP)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100340619 (CREBBP)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100340619 (CREBBP)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100340619 (CREBBP)
   05164 Influenza A
    100340619 (CREBBP)
   05161 Hepatitis B
    100340619 (CREBBP)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100340619 (CREBBP)
   05165 Human papillomavirus infection
    100340619 (CREBBP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    100340619 (CREBBP)
   03036 Chromosome and associated proteins [BR:ocu03036]
    100340619 (CREBBP)
   03029 Mitochondrial biogenesis [BR:ocu03029]
    100340619 (CREBBP)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100340619 (CREBBP)
Transcription factors [BR:ocu03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    100340619 (CREBBP)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100340619 (CREBBP)
Mitochondrial biogenesis [BR:ocu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    100340619 (CREBBP)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 100340619
NCBI-ProteinID: XP_008247815
Ensembl: ENSOCUG00000004458
LinkDB
Position
Un
AA seq 2327 aa
MASLGAMGKSPLNQGDSNASSLPKQAASTSGPTPPASQALNPQAQKQVGLVTSSPATSQT
GPGICMSANFNQTHPGLLNSNSGHSLMNQAQQGQAQVMNGSLGAAGRGRGAGMPYPAPAM
QGATSSVLAETLTQVSPQMAGHAGLNPAQAGGMPKMGMTGNTSPFGQPFSQTGGQQMGGA
GVNPQLSSKQSMVNSLPTFPTDIKNTSVTNVPNMSQMQTSVGIVPTQAIATGPTADPEKR
KLIQQQLVLLLHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCAS
SRQIISHWKNCTRHDCPVCLPLKNASDKRNQQTILGSPASGIQNTIGSVGTGQQNATSLS
NPNPIDPSSMQRAYAALGLPYMNQPQTQLQPQAPGQQPAQPPTHQQMRTLTPLGNNPMNI
PAGGMTADQQPPNLISESALPASLGATNPLMNDGSSSNIGTLSTIPAAAPPSSTGVRKGW
HEHVTQDLRSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYYH
LLAEKIYKIQKELEEKRRSRLHKQGILGNQPALPAPGAQPPGMPPTQPVRPPNGPLSLPV
TRMQVSQGMNSFNPMSLGNVQLPQAPMGPRAASPMNHSVQMNSMGSVPGMAISPSRMPQP
PNMMGAHANNMMAQTPTQNQFLAQNQFPSSSGAMSVNSVSMGQPTAQAGVAQGQVPGAAL
PNPLNMLGPQTSQLPCPPVTQSPLHPTPPPASAAAGLPSLQHPPPPGMTPPQPAAPAQPS
TPVSSSGQTPTPTPGSVPSAAQAQSTPTVQAASQAQVTPQPQTPVQPPSVATPQSSQQQP
TPVHVQPPSTPLSQAAASIDNRVPTPSSVASAETSSQQPGPDVPVLEMKAEVQAEDAEPD
PGEPKGEPRSEVMEEDLQGSSQIKEETDSTEQKPEPMEVDEKKPEVKVEAKEEEESSTNG
TASQSTSPSQPRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIV
KNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEI
DPVMQSLGYCCGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNRYHFCEKCFTEIQGENV
TLGDDPSQPQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCD
NCLKKTGRPRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTV
EVKPGMKSRFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRV
YISYLDSIHFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPP
DQKIPKPKRLQEWYKKMLDKAFAERIIHDYKDILKQATEDRLTSAKELPYFEGDFWPNVL
EESIKELEQEEEERKKEESTAASETTEGSQGDSKNAKKKNNKKTNKNKSSISRANKKKPS
VPSVSNDLSQKLYATMEKHKEVFFVIHLHAGPVINTLPPIVDPDPLLSCDLMDGRDAFLT
LARDKHWEFSSLRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLC
INCYNTKSHTHKMVKWGLGLDDEGSSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRNAN
CSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHK
LRQQQIQHRLQQAQLMRRRMATMNTRNVPQQSLPSPTSAPPGTPTQQPGTPQTPQPPAQP
QPSPVSMSPAGFPSVARTQPPTTVSAGKPTNQVPAAPPPAQPPPAAVEAARQIEREAQQQ
QHLYRVNINSGMPPGRTGLGTPGSQMAPVGLNVPRPSQVSGPGMPGMPPGQWQQAPLPPQ
QPMPGMPRPVMSMQAQAAVAGPRMPSVPPPRSISPSALQDLLRTLKSPSSPQQQQQVLNI
LKSNPQLMAAFIKQRTAKYVANQPGLQPQPGLQAQPGMHQQPGLQNLNAMQAGVPRPGVP
PQQQAMGGLNAPGQALNIMNPGHSPSVASMNPQYREMLRRQLLQQQQQQQQQQQQQQGGG
GVAGGVAGGMAGHGQFQQPQGPGGYAPAMQHXQRMQPHLPIQGSSMGQMAAQMGQLGQMG
QPGLGADGTPSIQQALQQRILQQQQMKQQMGSPGQPNPMSPQQHLLSGQPQASHLPGQQI
ATSLSNQVRSPAPVQSPRPQSQPPHSSPSPRIQPQPSPHHVSPQTGSPHPGLAVTMASSI
DQGHLGNPEQSAMLPQLNTPSRSTLSSELSLVGDTTGDTLEKFVEGL
NT seq 6984 nt   +upstreamnt  +downstreamnt
atggccagcctgggtgccatgggcaaaagccctctgaaccagggagactctaacgcgtcc
agcctgcccaagcaggcagccagtacctctgggcccacccctcctgcttcccaagcactg
aatccgcaagcacaaaagcaagtggggctggtgaccagcagccctgccacgtcgcagact
ggacctgggatctgcatgagtgctaacttcaaccagacccacccaggcctcctcaacagt
aactctggccatagcttaatgaatcaggcccagcaagggcaggcgcaagtcatgaacgga
tcccttggggctgctggcagaggaaggggagctggaatgccgtatcctgccccagccatg
caaggggccacgagcagtgtgctggctgagaccttaacacaggtttccccacagatggcc
ggccacgcgggactgaacccagcgcaggcaggaggcatgcccaagatgggaatgactggt
aacacaagtccatttggacaaccctttagtcaaactggagggcagcagatgggaggcgct
ggagtgaacccccagttatccagtaaacagagcatggtcaatagtttgcccaccttcccg
acagacatcaagaacacttcggtcaccaacgtgccaaatatgtcccagatgcaaacatca
gtgggaattgtacccacacaagcaattgcaactggccccactgcagatcctgaaaaacgc
aagctgatacagcagcagctggttctactgcttcacgctcataaatgtcagagacgagaa
caagcgaatggggaggttcgggcctgctctctgcctcactgtcgaaccatgaagaatgtc
ttgaatcacatgacacattgtcaggctgggaaagcctgccaagttgcccattgtgcatct
tcacgacaaatcatctctcattggaagaactgcacacgacatgactgtcctgtttgcctc
cctttgaaaaatgccagtgacaagcgaaaccaacaaaccatcctggggtctccagctagt
ggaattcagaacacaattggctctgttggcacagggcagcagaacgccacttctctaagt
aacccgaatcccatagaccccagctccatgcagcgagcctacgcggctctcggactgccc
tacatgaaccagccgcagacgcagctgcagccgcaggctcccggccagcaaccagcacag
cccccgacccaccagcagatgcggaccctcacccctctgggaaataaccctatgaacatt
ccagcaggagggatgacagcagatcagcagccaccaaacctgatttcagaatccgctctt
ccagcttcccttggagccaccaatcctctgatgaacgatggctccagctccaacatcggg
accctgagcaccatacccgcagcggcacctccttccagtaccggggtgcggaaaggctgg
cacgagcacgtcactcaggacctgcggagccatctggttcacaagcttgtccaagccatc
ttcccaacacctgatcccgcagccctcaaggatcgccgcatggagaacctggtcgcctat
gcgaagaaggtggaaggggacatgtatgagtctgccaacagcagggatgaatactatcat
ttattagcagagaaaatctacaagatacagaaagaactagaagaaaagcggaggtcacgt
ttacataagcagggcatcttgggtaaccagccagccttaccagcccctggggctcagccc
cccgggatgccaccgacacagcctgtcaggcctccaaatgggcccctgtccctgccagtg
acccgcatgcaggtttcccaagggatgaactcatttaacccaatgtccttggggaatgtc
cagttgccgcaagcacccatgggaccgagggcagcctcccccatgaaccactcggtgcag
atgaacagcatgggctccgtcccagggatggccatttctccttctcgaatgccccagcct
ccgaacatgatgggtgcacacgccaacaacatgatggcccagacgcccactcagaaccag
tttcttgcgcaaaaccagttcccgtcatcgagtggggcgatgagtgtgaacagtgtgagc
atggggcagccgacggcccaggccggagtggcgcaggggcaggtgcctggtgctgctctc
cctaaccctctgaacatgcttgggccccagaccagccagctgccctgccctccagtgacg
cagtcaccattgcacccgacgccacctcctgcctctgcggccgctggcctgccgtctctg
cagcacccgccgccacctggcatgacaccgccccagccagcggcacctgctcagccatcg
acccctgtgtcgtcttccgggcagacgcctaccccgactcctggctccgtgcccagtgct
gcccaagcacagagcacccccacggtgcaggcagcatcccaggcccaggtgaccccacag
cctcaaaccccggtgcagcccccgtctgtggccactccccagtcatcgcagcagcagccg
acacctgtgcatgtgcagcctcccagcacaccgctttcccaggcagcagccagcattgat
aatagggttcccacaccttcgtcagtggccagtgcggaaaccagttcccagcagccgggg
cccgatgtccctgtgctggaaatgaaggccgaggtgcaggccgaggatgccgagcccgac
cctggggaacccaaaggggagcctcggtctgaggtgatggaggaggatttgcagggctcc
tcccaaattaaagaagaaacagattctacagagcagaaaccagaaccaatggaagtggat
gaaaagaaacccgaagtaaaagtggaagctaaggaggaagaagagagcagcaccaatggg
acggcctcgcagtcaacatccccttcacagccacgcaagaaaatctttaaacctgaggag
ctacgccaggccctcatgccaaccctggaagcgctgtatcgacaggacccagagtcttta
ccgtttcggcagcctgtagatcctcagctgctaggaattccggattatttcgacattgtg
aagaatcccatggacctttctacgatcaagcggaaactggacacagggcagtaccaggaa
ccctggcagtacgtggatgacgtctggctgatgttcaacaatgcctggctctataaccgc
aagacctcgcgtgtctacaaattctgcagtaagcttgcagaagtctttgagcaggagatc
gaccccgtgatgcagtcccttggatattgctgtggacgcaagtatgaattctccccccag
actttgtgctgctacgggaagcagctgtgtacaatcccccgcgatgccgcctactacagc
tatcagaataggtatcatttctgtgagaagtgtttcacagagatccagggcgagaatgtg
accctgggtgacgacccttcacaaccccagacgacaatttcaaaggatcagtttgaaaag
aagaaaaacgataccttagaccccgaaccttttgttgattgcaaagagtgtggacggaag
atgcatcagatttgtgtgctgcattatgacatcatttggccttcgggctttgtatgcgac
aactgcttgaagaaaactggcagacctcgaaaagaaaacaaattcagtgctaagagactg
cagaccacacgcctgggaaaccacctggaagaccgagtgaacaaattcctgcggcgccaa
aaccaccctgaagccggggaggttttcgtcagagtggtggccagctcggacaagaccgtg
gaagtcaagcctgggatgaagtctcggtttgtggactctggggagatgtccgagtccttc
ccatatcgaaccaaagcgctctttgcttttgaggaaattgatggagtggatgtgtgcttc
tttggaatgcatgtccaagaatatggctccgattgcccgcctccaaacacaaggcgtgtg
tacatatcctacctggacagtattcacttcttccggccccgttgcctccggacagccgtt
taccacgagatccttattggatatctagaatatgtgaagaaattggggtatgtgacaggg
cacatctgggcctgtcccccaagtgaaggagacgactacatcttccattgccacccccct
gaccaaaaaatcccgaagccaaaacgcctgcaggagtggtacaagaagatgctggacaag
gcgttcgccgagcgcatcattcacgactacaaggacattctcaaacaagcaaccgaagac
aggctcaccagtgccaaggaactgccctattttgaaggtgatttctggcccaacgtgttg
gaggagagcatcaaggagctggagcaggaggaggaggagaggaagaaagaggagagcact
gccgccagcgagaccaccgagggcagtcagggcgacagcaagaacgccaagaagaagaac
aacaagaaaaccaacaagaataagagcagcatcagccgtgccaacaagaagaaacccagc
gtgcccagcgtgtccaacgacctgtcccagaagctgtatgccaccatggagaagcataag
gaggtcttctttgtgatccacctgcacgcagggcctgttatcaacaccctgccccccatc
gtcgacccagacccgctgctcagctgtgacctcatggatgggcgcgacgccttcctcacg
ctggccagggacaagcactgggagttctcctcactgcgccgctccaagtggtccacgctg
tgcatgctggtggagctgcacacccagggccaggaccgctttgtctacacctgtaacgag
tgcaagcaccacgtggagacacgctggcactgcacggtgtgcgaggactatgacctgtgc
atcaactgctacaacacgaagagccacacgcacaagatggtgaagtgggggctgggcctg
gacgacgagggcagcagccagggcgagccgcagtccaagagcccccaggagtcgcggcgc
ctgagcatccagcgctgcatccagtccctggtgcacgcctgccagtgccgcaacgccaac
tgctcgctgccgtcctgccagaagatgaagcgggtggtgcagcacaccaagggctgcaag
cggaagaccaacggcggctgcccggtgtgcaagcagctcatcgccctgtgctgctaccac
gccaagcactgccaggagaacaagtgccccgtgcccttctgcctcaacatcaaacacaag
cttcgccagcagcagatccagcaccggctgcagcaggcccagctcatgcgccggcggatg
gccaccatgaacacccgcaacgtgcctcagcagagtttgccttctcctacctcagctccg
cccgggacccccacacagcagcccggcacgccccagacgccgcagccccctgcccagccc
cagccttcacccgtgagcatgtcaccagccggcttccccagtgtggcccggactcagccc
cccacgactgtgtccgcagggaagcccaccaaccaggtgccggctgccccgccccctgcc
cagcccccacccgcggcggtggaggctgcccggcagattgagcgagaggcccagcagcag
cagcacctctaccgtgtgaacatcaacagcggcatgccccccgggcgcacgggcctgggg
acccccgggagccagatggcccctgtgggcctgaatgtgccacggcccagccaggtcagc
gggcccggcatgcccggcatgccgcctggacagtggcagcaggcgcccctccccccgcag
cagccaatgccaggcatgcccaggcctgtgatgtccatgcaggcccaggcagccgtggct
gggcccaggatgcccagcgtcccgccacccaggagcatctcgcccagcgccctgcaagac
ctcctgcggaccttgaaatcacccagctccccgcagcagcagcagcaggtgctgaacatc
ctcaagtccaacccgcagctaatggcagctttcatcaaacagcgcacagccaagtatgtg
gccaaccagcccggcctgcagccccagcccggcctgcaggcccagcccggcatgcaccag
cagcccggcctgcaaaacctgaacgccatgcaagcgggcgtgcctcggcctggggtgccc
ccccagcagcaggcaatgggaggcctgaacgccccgggccaggccttgaacatcatgaac
ccaggacacagccccagcgtggcgagcatgaatcctcagtaccgggagatgctgaggcgg
cagctactgcagcagcagcagcagcagcagcagcagcagcagcagcagcagggcggcggg
ggcgtggccgggggcgtggccgggggcatggctgggcacggccagttccagcagccgcag
ggacctggcggctacgcccccgccatgcagcacnngcagcgcatgcagccgcacctcccc
atccagggcagctccatgggccagatggccgctcagatgggacagctcggccagatggga
cagccggggctgggggcggacggcacccccagcatccagcaggctttgcagcagcggatt
ctgcagcagcagcagatgaagcagcagatggggtccccaggccagccgaaccccatgagc
ccccagcaacacctgctctcaggacagccgcaggcctcccacctccccggccagcagatc
gccacgtccctcagcaaccaggtgcggtctccagcccctgtgcagtctccgcggccccag
tcccagcctccacattccagcccgtcaccgcggatacagccccagccttcgccacaccac
gtctcgccccagactggttccccccatcccggactcgcagtcaccatggccagctccata
gatcagggacacttggggaaccctgaacagagtgcaatgctcccccagctgaacaccccc
agtaggagcacactgtccagcgaactgtccctggtcggtgacaccacaggggatacgcta
gaaaaatttgtggagggtttgtag

KEGG   Oryctolagus cuniculus (rabbit): 100354135
Entry
100354135         CDS       T03373                                 

Gene name
EP300
Definition
(RefSeq) E1A binding protein p300
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04024  cAMP signaling pathway
ocu04066  HIF-1 signaling pathway
ocu04068  FoxO signaling pathway
ocu04110  Cell cycle
ocu04310  Wnt signaling pathway
ocu04330  Notch signaling pathway
ocu04350  TGF-beta signaling pathway
ocu04520  Adherens junction
ocu04630  JAK-STAT signaling pathway
ocu04720  Long-term potentiation
ocu04916  Melanogenesis
ocu04919  Thyroid hormone signaling pathway
ocu04922  Glucagon signaling pathway
ocu04935  Growth hormone synthesis, secretion and action
ocu05016  Huntington disease
ocu05152  Tuberculosis
ocu05161  Hepatitis B
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05200  Pathways in cancer
ocu05203  Viral carcinogenesis
ocu05206  MicroRNAs in cancer
ocu05211  Renal cell carcinoma
ocu05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100354135 (EP300)
   04330 Notch signaling pathway
    100354135 (EP300)
   04350 TGF-beta signaling pathway
    100354135 (EP300)
   04630 JAK-STAT signaling pathway
    100354135 (EP300)
   04066 HIF-1 signaling pathway
    100354135 (EP300)
   04068 FoxO signaling pathway
    100354135 (EP300)
   04024 cAMP signaling pathway
    100354135 (EP300)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100354135 (EP300)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100354135 (EP300)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100354135 (EP300)
   04935 Growth hormone synthesis, secretion and action
    100354135 (EP300)
   04919 Thyroid hormone signaling pathway
    100354135 (EP300)
   04916 Melanogenesis
    100354135 (EP300)
  09156 Nervous system
   04720 Long-term potentiation
    100354135 (EP300)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100354135 (EP300)
   05206 MicroRNAs in cancer
    100354135 (EP300)
   05203 Viral carcinogenesis
    100354135 (EP300)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    100354135 (EP300)
   05215 Prostate cancer
    100354135 (EP300)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100354135 (EP300)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100354135 (EP300)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100354135 (EP300)
   05164 Influenza A
    100354135 (EP300)
   05161 Hepatitis B
    100354135 (EP300)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100354135 (EP300)
   05165 Human papillomavirus infection
    100354135 (EP300)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    100354135 (EP300)
   03036 Chromosome and associated proteins [BR:ocu03036]
    100354135 (EP300)
   03029 Mitochondrial biogenesis [BR:ocu03029]
    100354135 (EP300)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100354135 (EP300)
Transcription factors [BR:ocu03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    100354135 (EP300)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100354135 (EP300)
Mitochondrial biogenesis [BR:ocu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    100354135 (EP300)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 100354135
NCBI-ProteinID: XP_002721441
Ensembl: ENSOCUG00000011434
UniProt: G1T1B1
LinkDB
Position
Un
AA seq 2418 aa
MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGD
ISQLQTSLGIVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQVMASQAQQNSPGLGLINS
MVKSPMAQASLTSPNMGVGAGGPNQGPTQSTAGMMNSPVSQPAMGMNTGMNAGMNPGMLA
AGNGQGMMPNQVMNGSIGAGRGRPNMQYPNPSMGNAGNLLSEPLQQGSPQMGGQTGLRGP
QPLKMGMMSNPNPYGSPYTQSSGQQIGASGLGLQIQTKTVLPNSLSPFAMDKKGVPGGGM
PNMGQQPAPQVQQPGLVTPVAQGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANG
EVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKN
AGDKRNQQSILTGAPVGLGNPSSLGVGQQSTPSLSTVSQIDPSSIERAYAALGLPYQVNQ
MPTQPQVQAKSQQNQQSGQSPQGMRPMGNMNASPMGVNGGVGVQAPNLLSDSMLHSAINS
QNQLMNENASVASLGPMPTAAQPSSTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAA
LKDRRMENLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLP
NAGMVPVSMNPGPNMGQPQPGMTSNGPLPDPTMIRGSVPNQMMPRITPPSGLNQFGQMSM
PQPPIGPRQTSPLQHHGQLAQPGALNPPMGYGPRMQPPTSQSQFLPQSQFSSQGMNVANM
PLAPPSGQVPVSQAQISGSSCPVNSPIMPPGSQGSHMHCPPLAQPPLHQNSPSPVPSRTP
TPHHTPPSIGAQQPPAAGIPAPVPTPPAMPAGPQPQALHPPPRQTPTPPTTQLPPQVQPS
LPAAPPADQPQQPRSQQSTAASVPTPTVPLLPPQPATPLSQPTVSIEGQASNPPSTSSAE
VNAQAVPEKQPAQEVKVEAKMEVDQPEPAAVPPEDVPESKAEDCKVEPPETEERGTELKT
EIKEDDDQPSTSAPQSSPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDP
QLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYKY
CSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYHFC
EKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICALH
HEIIWPVGFVCDGCLKKTARTRKENKFSAKRLPSTRLGTFLENRVNDFLRRQNHPESGEV
TVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQEY
GSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACPPS
EGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDIFKQATEDRLTSAKEL
PYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKNKS
SLSRGSKKKPGVPSVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIVDPDPLIPC
DLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVETRW
HCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRCIQS
LVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQENKC
PVPFCLNIKQKLRQQQLQHRLQQAQMLRRRMASMQRTGVVGQQQGLPSPTPATPTTPTGQ
QPTTPQTPQPQPTSQPQPTPPNSMPPYLPRTQAAGPVSQGKAAGQVTPPTPPQTAQPPLP
GPPPAAVEMAMQIQRAAETQRQMAHVQIFQRPIQHQMPQMTPMTPMGMNPPPMARGPSGH
LEPGMGPAGMQQQPPWAQGGLPQPQQLQSGMPRPAMMSVAQHGQPLNMAPQPGLGQVGVS
PLKPGTVSQQALQNLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYANSSPQP
LPGQPGMPQGQPGLQPPTMPGQQGVHSNPAMQNMNPMQAGVQRAGLPQQPPPQQLQPPMG
GMSPQAQQMNMNHNTMPSQFRDILRRQQMMQQQQQGAGPGMGPGMANHNQFQQPQGVGYP
PQQQQQQQQRMQHHMQQMQQGNMGQMGQLPQALGAEAGASLQAYQQRLLQQQMGSPAQPN
PMSPQQHMLPSQAQSPHLQGQQIPNSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQPS
PHHVSPQTSSPHPGLVAAQANPMEQGHFASPDQNSMLSQLASNPGMANLHGASATDLGLS
TDNSDLNSNLSQSTLDIH
NT seq 7257 nt   +upstreamnt  +downstreamnt
atggccgagaatgtggtggaaccggggccgccttcagccaagcggcctaaactctcctcg
ccggccctctcggcgtcggccagcgacggcacagattttggttcactgttcgacctggag
cacgatttaccagatgaattgatcaactctacagaattgggactgaccaatggtggtgat
attagtcagcttcagacaagtcttggcatagtacaagatgcagcctccaaacataaacag
ctgtcagaattgctgcgatctggtagttcccctaacctcaatatgggggttggtggccct
ggccaagtcatggccagccaggcccaacagaacagtcctggattaggtttgataaacagc
atggtcaaaagcccaatggcacaggccagcttgacttctcccaacatgggagtgggtgct
ggtggaccaaatcagggtcccacgcagtccacagcaggcatgatgaacagtccagtcagt
cagcctgccatgggaatgaacacagggatgaatgctggcatgaatcctggaatgttggct
gcaggcaatggacaggggatgatgcctaatcaagtcatgaacggttcaattggagcaggc
cgagggcgaccgaatatgcagtacccaaacccaagcatgggaaatgctggcaacttactg
tcagagccactgcagcagggctctcctcaaatgggaggacaaacaggattgagaggcccc
cagcctcttaagatgggaatgatgagcaaccccaacccttatggttccccatatactcag
agttctggacagcagattggagccagtggccttggtctccagattcagacaaagactgta
ctaccaaatagtttatctccgtttgcaatggataaaaagggtgttcccggtggaggaatg
cccaacatgggccaacagcctgccccgcaggtccagcaaccgggcctggtgactccagtt
gcccaaggaatgggttctggagcacacacagctgaccccgaaaaacgcaagctcattcag
cagcagcttgttctccttttacacgcacacaagtgccagcgccgggagcaggctaatgga
gaagtgaggcagtgcaaccttccccactgtcgcaccatgaagaatgtcctaaaccacatg
acgcactgccagtcaggcaagtcctgccaagtggcacactgtgcatcttctcgacaaatc
atttcacactggaagaattgtacaaggcatgattgtcctgtgtgtcttcctctcaaaaat
gctggggataagagaaatcaacagtcaattttgactggcgcacctgttggattaggaaac
cctagctctctaggggtgggtcagcagtctacccccagcctaagcacggtcagtcagatt
gatcccagttctatagaaagagcctatgcagctcttggactaccctaccaagtaaatcag
atgccgacccaaccccaagtgcaagcgaagagccaacagaatcagcagtctgggcagtct
ccccaaggcatgcggcctatgggcaacatgaatgctagccctatgggagtcaatggaggt
gtaggcgttcaagcaccaaatcttctttctgactccatgttgcattcagccataaattct
cagaaccaattgatgaatgaaaatgccagcgtggcctccctgggtcctatgccaacagca
gctcaaccatcaagtactggtattcggaaacagtggcatgaagacataactcaggatctt
cgaaatcatcttgttcataaactagttcaagccatatttcccactccggatcctgctgct
ttaaaggacagacggatggaaaacctggtggcatatgctcggaaggtagaaggggacatg
tacgaatctgcaaataatcgagcggaatactaccaccttctagctgagaagatctataag
atacaaaaagaattagaagaaaaacgaaggactagattacagaaacagaacatgcttcca
aatgcaggcatggtgccagtttctatgaatccagggcctaacatgggacagccacaacca
ggaatgacttctaatggtcctctccctgacccaactatgatccgcggcagtgtgccaaac
cagatgatgcctcggataacaccaccatctggtttgaatcaatttggccagatgagtatg
ccccagccccctattggaccccggcaaacctctccacttcagcaccatggacagttggct
cagcctggagctctaaacccgcctatgggctatgggcctcgcatgcagccgcctaccagc
cagagccagtttcttccacagtctcagttctcatcacagggaatgaatgtagcaaatatg
cctttggctccacccagcggtcaagtaccagtgtctcaagcacaaatatctggttcttcc
tgcccagtaaactcgcctataatgcctccaggatctcaaggaagccacatgcactgtccc
cctctggcacaaccccctctgcatcagaattcaccatctcctgtacctagtcgtaccccg
acccctcaccacactcctccaagcataggggcccagcagccaccagcagcagggatccca
gcccctgtccctacacctcctgccatgccggccgggccacagccccaggctctgcaccct
cctccgagacagacacctactccgcccacaacacagctgcctccccaagtgcagccgtcg
ctccctgctgctcctccagccgaccagccccagcagccccgctctcagcagagtacagca
gcctcggtccccaccccgacggtgccactgctgcctccgcagcccgccactccgctttcc
cagccgactgtgagcattgaagggcaagcgtcaaaccctcccagcacgagcagtgcagag
gtgaacgctcaggctgtccctgagaagcagcctgcacaggaagtaaaggtggaggctaag
atggaggtggaccagccagaaccagcagctgttccaccagaggatgtcccagagagcaaa
gctgaggactgtaaagtggagcctccagaaacagaagagagaggcactgagttaaaaacc
gaaatcaaagaagatgacgaccagccaagtacttccgccccccagtcatctccagctcct
ggccagtcgaagaaaaagattttcaaaccagaagaactacgacaggcactgatgccaacc
ttggaggcactttaccgccaggatccagagtcccttccctttcgtcagcctgtggaccct
cagcttcttggaatccctgattactttgatattgtgaagagccccatggatctgtctacc
atcaagaggaagttagatacaggacagtatcaggagccctggcagtatgttgatgacatt
tggcttatgttcaacaatgcctggttatataaccggaaaacgtcgcgggtatacaaatac
tgctccaagctgtctgaagtcttcgaacaagaaattgatcctgtcatgcaaagccttgga
tactgttgtggcagaaagttggagttttctccacagacactgtgttgctacggcaaacag
ttgtgcaccatccctcgtgatgccacttactacagttaccagaataggtatcatttctgt
gagaagtgtttcaatgaaatccaaggggagagcgtttctttgggggatgacccttcccag
cctcaaactacaataaataaagaacagttttcaaagagaaaaaacgacacactggatcct
gaactgttcgtagagtgtaccgagtgtggaagaaagatgcaccagatatgtgccctccat
catgagatcatctggccagtgggatttgtctgtgatggctgcttaaagaaaactgcacga
actagaaaagaaaacaagttttctgctaaaaggttgccgtctaccagacttggcaccttt
ctggagaatcgtgtaaatgactttctgaggcggcaaaatcaccccgagtctggagaggtc
actgttagagtagttcatgcttctgacaaaactgtggaagtcaagccaggcatgaaagca
aggtttgtagatagtggagagatggcagaatcctttccataccgaaccaaagccctcttt
gcctttgaagagattgacggtgttgacttgtgtttctttggaatgcacgttcaagagtat
ggctctgactgccctccacccaaccagaggagagtgtacatatcttacctcgacagtgtt
cacttcttccgtcctaaatgcttgagaactgcagtctatcatgaaatcctgattggatat
ttagagtatgtcaagaaattgggatacacgacagggcacatttgggcatgtcctccaagt
gagggggatgactatatcttccactgtcatcctccggaccagaagatacccaagcccaag
cgactgcaggaatggtacaaaaaaatgcttgacaaggcagtttctgagcgcattgtccac
gactacaaggatatttttaagcaagctaccgaagatcggttaacaagcgcaaaggagttg
ccttactttgagggtgatttctggcccaatgttctggaagagagcattaaggaactggaa
caggaggaagaagagaggaagcgagaagaaaacaccagcaatgagagcacagatgtgaca
aagggagacagcaagaatgctaaaaagaagaacaataaaaagaccagcaaaaacaagagc
agcctgagcaggggcagcaagaagaagcctggggtgcccagtgtttccaacgacctctca
cagaagctctacgccaccatggagaagcacaaagaggtcttctttgtgatccgcctcatt
gctggccctgctgccaactccctgcctcccatcgttgatcctgaccctctcatcccctgc
gatctgatggatggtcgtgatgcctttctcacccttgcaagggacaagcacctggaattc
tcttccctccgaagagcccagtggtccaccatgtgcatgctggtggagctgcacacgcag
agccaggaccgctttgtctacacgtgcaatgagtgcaagcaccacgtggagacgcgctgg
cactgcaccgtctgtgaggattatgatttgtgcatcacctgctataacactaagaaccat
gaccacaaaatggagaaactaggtctcggcttagatgacgagagcaacaaccagcaggct
gcggccacccagagccctggagactctcgccgcttgagcatccagcgctgcatccagtcc
ctggtgcacgcctgccagtgccggaatgccaactgctccctcccctcctgccagaagatg
aagcgagtcgtgcagcataccaaaggttgcaagcggaaaaccaatggcgggtgccccatc
tgcaagcagctcattgccctgtgctgctaccacgccaaacactgccaggagaacaagtgc
cctgtgccgttctgcctgaacatcaagcaaaaactccggcaacagcagctgcagcaccgg
ctccagcaggcccagatgctccgcaggaggatggccagcatgcagcggactggggtggtg
gggcagcagcagggcctgccctctccgactcctgccactcccaccacgccaactggccaa
cagcctaccaccccacagacccctcagccccagcccacctctcagccccagcccacgcct
cccaacagcatgcctccgtatttgcccaggactcaagctgctggccctgtgtcccagggt
aaggcagcaggccaggtgacccctccaaccccacctcagactgctcagccacccctccca
gggccgccacctgcagcagtggaaatggcaatgcagattcagagggcagccgagacgcag
cgccagatggcccatgtgcaaatttttcaaaggccgatccagcatcagatgccccagatg
acgcccatgacccccatgggtatgaacccacctcccatggcccggggtcccagcgggcat
ttggagccagggatggggccagcagggatgcagcaacagccaccctgggctcaaggaggt
ttgcctcagccccagcagttgcagtctgggatgccgaggccagctatgatgtcagtggcc
cagcatggtcagcccttgaacatggctccccagccaggattgggccaggtaggggtgagc
cctctcaaaccaggcactgtgtctcaacaagccttacaaaacctcctgcggactctcagg
tctcccagctctcccctacagcagcaacaggtgcttagtatccttcacgccaacccccag
ctgttggctgcgttcatcaagcagcgggctgccaagtacgccaactctagtccacaacct
cttcctgggcagcctggcatgccccaggggcagccagggctacagccacctaccatgcca
ggtcagcagggagtccactccaatccagccatgcagaacatgaatcccatgcaggcgggc
gtccagagggctggcctgccacagcagccgccaccgcagcaactccagccacccatgggc
gggatgagcccccaagctcagcagatgaacatgaatcacaacaccatgccttcccagttc
cgagacatcttgagacggcagcagatgatgcagcagcagcagcagggagcaggacccgga
atgggccctggaatggccaaccataaccagttccagcagccccaaggagtcgggtacccc
ccccagcagcagcagcagcagcagcagcggatgcagcatcacatgcaacagatgcaacaa
gggaacatgggacagatgggccagctcccccaggccttgggagcagaagccggagccagt
ctgcaggcctatcagcagcgactcctgcagcaacagatggggtcccccgctcagcccaac
cccatgagcccccagcagcacatgctcccaagtcaggcccagtccccacacctacaaggc
cagcagatccctaactctctctccaatcaagtgcgctctccccagcctgtcccttctccg
cggccacagtctcagcccccccactccagcccttccccaaggatgcagcctcagccttct
ccacaccacgtttcaccgcagaccagttccccgcatccaggactggtagctgcccaggcc
aaccccatggaacaagggcattttgctagcccggaccagaattcaatgctttctcagctc
gctagcaatccaggcatggcaaacctccatggtgcaagcgccacggacctgggactcagc
accgataattcagacttgaattcaaacctctcacagagtacactagacatacactag

DBGET integrated database retrieval system