KEGG   Oryctolagus cuniculus (rabbit): 100340625
Entry
100340625         CDS       T03373                                 

Gene name
CDKN2A
Definition
(RefSeq) cyclin-dependent kinase inhibitor 2A
  KO
K06621  cyclin-dependent kinase inhibitor 2A
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01522  Endocrine resistance
ocu01524  Platinum drug resistance
ocu04110  Cell cycle
ocu04115  p53 signaling pathway
ocu04218  Cellular senescence
ocu04934  Cushing syndrome
ocu05163  Human cytomegalovirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05200  Pathways in cancer
ocu05203  Viral carcinogenesis
ocu05206  MicroRNAs in cancer
ocu05212  Pancreatic cancer
ocu05214  Glioma
ocu05218  Melanoma
ocu05219  Bladder cancer
ocu05220  Chronic myeloid leukemia
ocu05223  Non-small cell lung cancer
ocu05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100340625 (CDKN2A)
   04115 p53 signaling pathway
    100340625 (CDKN2A)
   04218 Cellular senescence
    100340625 (CDKN2A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100340625 (CDKN2A)
   05206 MicroRNAs in cancer
    100340625 (CDKN2A)
   05203 Viral carcinogenesis
    100340625 (CDKN2A)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100340625 (CDKN2A)
   05225 Hepatocellular carcinoma
    100340625 (CDKN2A)
   05214 Glioma
    100340625 (CDKN2A)
   05220 Chronic myeloid leukemia
    100340625 (CDKN2A)
   05218 Melanoma
    100340625 (CDKN2A)
   05219 Bladder cancer
    100340625 (CDKN2A)
   05223 Non-small cell lung cancer
    100340625 (CDKN2A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100340625 (CDKN2A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100340625 (CDKN2A)
   05163 Human cytomegalovirus infection
    100340625 (CDKN2A)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100340625 (CDKN2A)
   01522 Endocrine resistance
    100340625 (CDKN2A)
SSDB
Motif
Pfam: Ank_4 Ank_5 Ank_2 Ank
Other DBs
NCBI-GeneID: 100340625
NCBI-ProteinID: XP_002708009
LinkDB
Position
1
AA seq 148 aa
MEPSADRLATAAARGRVEEVRALLEAGVPPDAPNRYGRSAIQVMMMGSARVAELLLLHGA
EPNCADPATLSRPVHDAAREGFLDTLVALHRAGARLDVRDAGGRLPVDLAEERGHRDVAR
YLRAAEGGNHARARAVEGTADTPNSNDL
NT seq 447 nt   +upstreamnt  +downstreamnt
atggagccctcggcggacaggctggccacggccgcggcgcggggccgggtggaggaggtg
cgggcgctgctcgaggccggagtgccgcccgacgctcctaaccgctatggtcggtcggcg
atccaggtcatgatgatgggcagcgcccgcgtggccgagctgctgctgctccacggcgcc
gagcccaactgcgccgaccccgccaccctcagccgaccggtgcacgacgccgcccgggag
ggcttcttggacacgctggtggcgctgcaccgggccggggcgcggctggacgtgcgcgac
gccgggggccgcctgcccgtggacctggctgaggagcggggccaccgcgacgtcgctcgg
tacctgcgcgccgccgaaggcggtaaccacgcccgcgcaagggccgtggaaggtaccgca
gacactccgaactcaaacgatctttga

DBGET integrated database retrieval system