KEGG   Oryctolagus cuniculus (rabbit): 100340648
Entry
100340648         CDS       T03373                                 

Gene name
CPSF6
Definition
(RefSeq) cleavage and polyadenylation specific factor 6
  KO
K14398  cleavage and polyadenylation specificity factor subunit 6/7
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100340648 (CPSF6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100340648 (CPSF6)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Pre-mRNA cleavage factor Im (CFIm)
     100340648 (CPSF6)
SSDB
Motif
Pfam: RRM_1 PRP38_assoc
Other DBs
NCBI-GeneID: 100340648
NCBI-ProteinID: XP_002711368
Ensembl: ENSOCUG00000013505
LinkDB
Position
4
AA seq 551 aa
MADGVDHIDIYADVGEEFNQEAEYGGHDQIDLYDDVISPSANNGDAPEDRDYMDTLPPTV
GDDVGKGAAPNVVYTYTGKRIALYIGNLTWWTTDEDLTEAVHSLGVNDILEIKFFENRAN
GQSKGFALVGVGSEASSKKLMDLLPKRELHGQNPVVTPCNKQFLSQFEMQSRKTTQSGQM
SGEGKAGPPGGSSRAAFPQGGRGRGRFPGAVPGGDRFPGPAGPGGPPPPFPAGQTPPRPP
LGPPGPPGPPGPPPPGQVLPPPLAGPPNRGDRPPPPVLFPGQPFGQPPLGPLPPGPPPPV
PGYGPPPGPPPPQQGPPPPPGPFPPRPPGPLGPPLTLAPPPHLPGPPPGAPPPAPHVNPA
FFPPPTNSGMPTSDSRGPPPTDPYGRPPPYDRGDYGPPGREMDTARTPLSEAEFEEIMNR
NRAISSSAISRAVSDASAGDYGSAIETLVTAISLIKQSKVSADDRCKVLISSLQDCLHGI
ESKSYGSGSRRERSRERDHSRSREKSRRHKSRSRDRHDDYYRERSRERERHRDRDRDRDR
ERDREREYRHR
NT seq 1656 nt   +upstreamnt  +downstreamnt
atggcggacggtgtggaccacatagacatttacgcggatgtgggcgaagagttcaaccag
gaagcagaatatggtggacatgatcagatagatttgtatgatgatgtcatctctccatct
gcaaataatggcgatgccccagaagatcgagattacatggatactctcccgccaactgtt
ggtgatgatgtgggaaaaggagcagcaccaaatgttgtctatacgtatactggaaagaga
attgcattgtatattggaaacttaacatggtggacaacagatgaagacttgactgaagca
gtccattctttgggagtaaatgatattttggagataaaattttttgagaatcgggcaaat
ggccagtcaaaggggtttgccctcgttggtgttggatctgaagcatcttcaaaaaagtta
atggatttgttgcctaaaagagaacttcatggtcagaatcctgttgtaactccatgcaat
aaacagttcctgagtcaatttgaaatgcagtccaggaaaactacacaatcaggacaaatg
tctggggaaggtaaagctggtcctccaggaggcagttcacgtgcagcatttccacaaggt
ggtagaggacggggccgttttccaggggctgttcccggtggggacagatttcctgggcca
gcaggaccaggagggccaccccctccttttccagctggacagactccgccacgtccaccc
ttgggtcctccaggcccacctggcccaccaggtcctccacctcctggtcaggttctgcca
cctcctctagctgggcctcctaatcgaggagatcgccctccaccaccagttctctttcct
ggacaaccttttgggcagcctccactgggtccacttcctcctggccctccacctccagtt
ccaggctacggcccccctcctggtccaccacctccacaacagggaccacctccaccacca
ggcccttttccacctcgcccacctggtccacttgggccaccccttacactcgctcctcct
ccgcatcttccgggaccaccaccaggtgccccgccgccagctccacatgtgaacccggct
ttctttcctccgccaactaacagtggcatgcctacatccgatagccgaggtccaccacct
acagacccatatggccgaccgccaccatatgataggggtgactatggccctccaggaagg
gaaatggatactgcaagaacaccattgagtgaagctgaatttgaagaaatcatgaatagg
aacagggcaatctcaagcagtgctatttcaagagctgtgtctgatgccagtgctggtgat
tatgggagtgctattgagactttggtaactgcaatttctttaattaaacaatccaaagta
tctgccgatgatcgttgcaaagttcttattagttctttgcaagattgccttcatggaatt
gagtccaagtcctatggttctggatcaagacgtgaacgatcaagagagagggaccatagc
agatcacgagaaaagagtcggcgtcataaatcccgtagtagagatcgtcatgatgattac
tatagagagagaagcagagaacgagaaagacaccgggatcgggaccgagatcgggaccga
gaacgtgaccgagagcgagagtatcgtcatcgttag

KEGG   Oryctolagus cuniculus (rabbit): 100353973
Entry
100353973         CDS       T03373                                 

Gene name
CPSF7
Definition
(RefSeq) cleavage and polyadenylation specific factor 7
  KO
K14398  cleavage and polyadenylation specificity factor subunit 6/7
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100353973 (CPSF7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100353973 (CPSF7)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Pre-mRNA cleavage factor Im (CFIm)
     100353973 (CPSF7)
SSDB
Motif
Pfam: RRM_1
Other DBs
NCBI-GeneID: 100353973
NCBI-ProteinID: XP_008272636
Ensembl: ENSOCUG00000024726
LinkDB
Position
Un
AA seq 462 aa
MSEGVDLIDIYADEEFNQDPEFNNTDQIDLYDDVLTATSQPSDDRSSSTEPPPPVRQEPS
PKPNNKTPAILYTYSGLRNRRAAVYVGSFSWWTTDQQLIQVIRSIGVYDVVELKFAENRA
NGQSKGYAEVVVASENSVHKLLELLPGKVLNGEKVDVRPATRQNLSQFEAQARKRIPPRA
HSRESSDSADGRATPSENLVPSSARVDKPPSVLPYFNRPPSALPLMGLPPPPIPPPPPLS
SSFGVPPPPPGIHYQHLMPPPPRLPPHLAVPXPGAIPPALHLNPAFFPPPNATVGPPPDT
YMKASTPYNHHGSRDSGPPPSTVSEAEFEEIMKRNRAISSSAISKAVAGASAGDYSDAIE
TLLTAIAVIKQSRVANDERCRVLISSLKDCLHGIEAKSYSVGASGSSSRKRHRSRERSPS
RSRESSRRHRDLLHNEDRHDDYFQERNREHERHRDRERDRHH
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgtcagaaggagtggacttgattgatatatacgctgatgaggagttcaaccaggaccca
gagttcaacaacacagatcagattgacctgtatgatgatgtgctgacagccacctcacaa
ccctcagatgacagaagtagcagcactgagccaccgcctcctgttcgccaggagccttct
cccaagcccaacaacaagactcctgcaattctgtatacctacagtggcctgcggaacaga
cgagctgcagtctatgtgggcagcttttcctggtggaccacagaccagcagctgatccag
gttattcgctctataggagtctatgatgtggtggagttgaaatttgcagagaatcgagca
aatggccagtccaaagggtatgctgaggtggtggtagcctctgaaaactctgtccacaaa
ttgttggaacttcttccaggaaaagttcttaatggagaaaaagtggatgtgaggccggcc
acccggcagaacctatcacagtttgaggcacaggctcggaaacgaatacctccacgtgcc
cactcccgagagtctagtgattctgcagatggacgggccacaccctctgagaaccttgta
ccctcatccgctcgtgtggataagccccccagcgtgctgccctacttcaatcgccctcct
tcagcccttcccttgatgggtctgcccccacccccaattccacccccaccacctctctcc
tcaagctttggggttcctccccctcctcctggcatccactaccagcatctcatgcctccc
cctcctcgattacctcctcatctggcagtacctncccctggggccatcccacctgccctt
cacctcaatccagccttcttccccccaccaaatgctacagtggggcctccaccagatact
tacatgaaggcctctacaccctataaccaccatggcagccgagattcgggccctccgccc
tctacagtgagtgaagctgaatttgaagagatcatgaagcgaaacagagcaatttccagc
agtgccatttccaaagcagtagctggagccagtgcaggggattacagtgatgcgattgag
acgctgctcacagccattgcggttatcaaacagtcccgggtcgccaatgatgagcgttgc
cgtgtcctcatctcctctcttaaggactgtcttcatggcattgaggccaagtcctacagt
gtgggtgccagcgggagctcttccaggaaaagacatcggtccagggagaggtcgcctagc
cggtcccgggagagcagcaggaggcaccgggatctgcttcataatgaagatcggcatgac
gactacttccaagaaaggaaccgggagcatgagagacaccgggatagagagcgggaccgg
caccactga

DBGET integrated database retrieval system