KEGG   Oryctolagus cuniculus (rabbit): 100340710Help
Entry
100340710         CDS       T03373                                 

Gene name
RET
Definition
(RefSeq) ret proto-oncogene
  KO
K05126  proto-oncogene tyrosine-protein kinase Ret [EC:2.7.10.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu05200  Pathways in cancer
ocu05216  Thyroid cancer
ocu05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100340710 (RET)
   05230 Central carbon metabolism in cancer
    100340710 (RET)
  09162 Cancer: specific types
   05216 Thyroid cancer
    100340710 (RET)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100340710 (RET)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100340710 (RET)
Protein kinases [BR:ocu01001]
 Receptor tyrosine kinases (RTK)
  RET family
   100340710 (RET)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr RET_CLD1 RET_CLD4 RET_CLD3 Pkinase Cadherin Haspin_kinase Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 100340710
NCBI-ProteinID: XP_017193931
Ensembl: ENSOCUG00000011141
LinkDB All DBs
Position
Un
AA seq 1189 aa AA seqDB search
MVLVEVMVAVMEVMVVEVMGDGFCGGDGGGVMEVMMMVMMEVVVEMEVMMVMMMEVVVEM
EVIVEMMVMEVMMEVVVEMEVIVEMTEAMVMMERPTPTELSIMLLAHSGTHPEPSNSLGN
VHMWTVSRHPRAASASIPVSAAPLGLYFSRDAYWEKLYVDQPAGTPLLYVHALRDAPGEV
ASFRLGQHLYGAYRTRLHENEWIRIHEDTGLLYLNRSLDQSTWEKLSLRNGGFPLLTIFL
QVFLSPVSLREAECQWPGCARVYFSCINSSFPACSSLSPRELCFPETDLSFRIRENKPPG
TFHQFRLLPVQFLCPNISVTYGLLEGKDGPFRCAPDSLEVSTLWALDREQREKYELVAKC
TVRVGAREEAVMVPFPVTVYDEDDSPPTFPGGVDTADAVVEFKRKEGTVVATLRVFDADV
VPASGELVRRYTSTLLPGDPWAQQTFRVEHAPNETLALANDTFVRATVHDYRLVLNRSIP
ISESRALQLAVLVNDSDFQGPGTGVLLLHFNVSVLPVSLHLPEAYAFSVSRRARRYAQIG
KVCVEHCHEFSGIHVQYKLQPSGANCSALGVVTSAEDTSGTVFVNASEPLRRPECTELQY
TVVATDRQTRRQAQAPLLVTVEGMYVTEEAGCPLSCAVSKRRPECEECGGLGSPTGRCEW
RQGDGKGISRNFSTCSPSTKTCPDGHCDTVESRDPNICPQDCLRGSIVGGHEPGERRGIR
AGYGICNCFPEEKKCFCEPEDSQGPLCDELCRTVIAAAVLFSFIVSVLLSTFCIHRYHKH
AHKPPIASAEMTFCRPAQAFPVSYSSSGARRPSLDSMENQVSVDAFKIPEDPKWEFPRKN
LVLGKTLGEGEFGKVVKATAFRLKGRAGYTTVAVKMLKENASPSELRDLLSEFNLLKQVN
HPHVIKLHGACSQDGPLLLIVEYAKYGSLRGFLRDSRKVGPGYVSGGGGRNSGSLDHPDE
RALTMGDLISFAWQISRGMQYLAEMKLVHRDLAARNILVAEGRKMKISDFGLSRDVYEED
SYVKRSKGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIPPERLFNL
LKTGHRMERPDNCSEEMYRLMLQCWKQEPDKRPVFADISKDLEKMMVKSRDYLDLAASTP
SDSLLYEDGLSEEETPLVDCNNAPLPRALPSTWIENKLYGRISHAFTRF
NT seq 3570 nt NT seq  +upstreamnt  +downstreamnt
atggttttggtggaggtgatggtggcggtgatggaggtgatggtggtggaggtgatggga
gatggtttttgtggaggtgatggtggtggagtgatggaggtgatgatgatggtgatgatg
gaggtggtagtggagatggaggtgatgatggtgatgatgatggaggtggtagtggaaatg
gaggtgatagtggagatgatggtgatggaggtgatgatggaggtggtagtggagatggag
gtgatagtggagatgacggaggcgatggtgatgatggagcgtcctacacccacggagctc
agcatcatgctgcttgcacacagcggcacccacccggagcccagcaacagccttgggaat
gtgcacatgtggacagtcagccgccatccccgcgctgcctcagcatcgatccctgtttct
gcagcccccctgggcctctacttctcacgggatgcctactgggagaagctgtacgtggac
cagccggccggcacgcccctgctgtacgtgcacgcgctgcgggacgccccaggggaggtg
gccagcttccgcctgggccagcacctctacggagcctaccgcacccggctgcacgaaaac
gagtggatccgcattcacgaggacaccggccttctgtacctcaaccgcagcctggaccag
agcacctgggagaagctcagcctgcgcaatggcggcttccccctgctcaccatcttcctc
caggtcttcctgtcccccgtgtccctgcgcgaggccgagtgccagtggcccggctgtgca
cgcgtctacttctcctgcatcaactcctccttccccgcctgcagctcgctctcgccccgc
gagctctgcttcccggagaccgacctctccttccgcatccgggagaacaagccgcccggc
accttccaccagttccggctgctgcccgtgcagttcctgtgccccaacatcagcgtgacc
tacgggctcctggaaggtaaggacgggcccttccgctgtgccccggacagcctagaggtg
agcacgctctgggccctggaccgcgagcaacgggagaagtacgagctggtggccaagtgc
acggtgcgcgtgggcgcgcgcgaggaggccgtgatggtgcccttccccgtgaccgtctac
gatgaggacgactcgccgcccaccttcccggggggcgtggacaccgccgacgccgtggtg
gagttcaagcgcaaggagggcaccgtggtggccacgctgcgtgtctttgatgcggacgtg
gtgccagcgtcgggagagctggtgaggcggtacacgagcaccctgctccccggggacccc
tgggcccagcagaccttccgcgtggagcacgcccccaacgagaccttggctctggccaac
gacaccttcgtgcgagcgacggtgcatgactacaggctggttctcaaccggagcatcccc
atctcagagagccgcgccctgcagctggccgtgctggtcaacgactcggacttccagggc
cccgggacaggggtgctcctcctgcatttcaatgtgtccgtgctgcccgtcagtctgcac
ctgcctgaagcctacgccttctctgtgagcagaagggcccgccgctacgcccagattggc
aaggtgtgcgtggagcactgccatgagttcagcggcatccacgtccagtacaagctgcag
ccctccggcgccaactgcagcgccctgggcgtggtcacctcagccgaggacacctccggc
accgtgtttgtgaacgcctcggagcccctgcggcggccggaatgcaccgagctccagtac
actgtggtggccaccgaccggcagacgcgcaggcaggcgcaggccccgctgctcgtcacc
gtggaggggatgtacgtgactgaggaggcaggctgccccctgtcctgcgcagtcagcaag
aggcggcccgagtgtgaggagtgcggtggcctgggctccccgacgggcaggtgcgaatgg
cggcaaggcgacggcaaagggatcagcaggaatttctccacctgctctcccagcaccaag
acctgccccgacggccactgtgacaccgtggagagcagagacccgaacatctgcccccag
gactgcctccgggggagcatcgttgggggacatgagcccggggagcgccgggggatcaga
gctggctacggaatctgcaactgcttcccagaggagaagaagtgtttctgtgagccggag
gacagccagggcccgctgtgtgacgagctgtgccgcacggtgatcgccgccgccgtgctc
ttctccttcatcgtctcggtcctgctctccaccttctgcatccaccgctaccacaagcat
gcgcacaagccgcccatcgcctcggccgagatgaccttctgcaggcccgcccaggccttc
ccggtcagctactcctcgtccggggcccgccggccctcgctcgactccatggagaaccag
gtctccgtggatgccttcaagatcccggaggatccaaagtgggaattcccgcggaagaac
ttggttcttggaaagaccctgggagaaggcgagtttggaaaagtggtcaaggcgacagcc
ttccgtctgaagggcagagccgggtacaccacggtggctgtgaagatgctgaaagagaac
gcctcccccagcgagctgcgggacctcctgtccgagttcaacctgctgaagcaggtgaac
cacccccatgtcatcaagctgcacggggcctgcagccaggatgggccactgctcctgatc
gtggagtacgccaagtacggctccctgcgtggcttcctgcgggacagccgcaaggtgggg
ccgggctacgtgagcggcggaggcggccgcaactcgggctccctggaccacccggacgag
cgggccctgaccatgggcgacctcatctccttcgcctggcagatctcacgggggatgcag
tacctggccgagatgaagctggtccatcgggacctggccgccagaaacatcctggtggct
gaggggcgaaagatgaagatctcggattttgggctgtcccgagatgtttatgaagaggat
tcctacgtgaagaggagcaagggtcggattccagttaagtggatggcaatcgagtccctt
tttgatcatatctacaccacccaaagtgatgtgtggtcctttggtgtcctgctgtgggag
atcgtgaccctggggggcaacccctaccccgggattcctcctgagcggctcttcaacctt
ctaaagaccggccaccggatggagaggccggacaactgcagcgaagaaatgtaccgcctg
atgctgcaatgctggaagcaagaaccggacaagaggccggtgtttgccgacatcagcaaa
gacctggagaagatgatggttaagagcagagactacctagacctggccgcgtccacgccg
tccgactcgctgctttatgaggatggtctctcggaagaagagacacccctggtggactgt
aataatgctcccctccctcgcgcccttccttccacatggattgaaaacaaactctatggt
agaatttcacatgcctttactagattctag

DBGET integrated database retrieval system