KEGG   Oryctolagus cuniculus (rabbit): 100340832
Entry
100340832         CDS       T03373                                 

Gene name
RASSF1
Definition
(RefSeq) Ras association domain family member 1
  KO
K09850  Ras association domain-containing protein 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04014  Ras signaling pathway
ocu04390  Hippo signaling pathway
ocu04392  Hippo signaling pathway - multiple species
ocu05200  Pathways in cancer
ocu05206  MicroRNAs in cancer
ocu05219  Bladder cancer
ocu05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100340832 (RASSF1)
   04390 Hippo signaling pathway
    100340832 (RASSF1)
   04392 Hippo signaling pathway - multiple species
    100340832 (RASSF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100340832 (RASSF1)
   05206 MicroRNAs in cancer
    100340832 (RASSF1)
  09162 Cancer: specific types
   05219 Bladder cancer
    100340832 (RASSF1)
   05223 Non-small cell lung cancer
    100340832 (RASSF1)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 Mst1_SARAH
Other DBs
NCBI-GeneID: 100340832
NCBI-ProteinID: XP_008258916
LinkDB
Position
9
AA seq 340 aa
MSAEPELIELRELAPAGRAGPGRTRLERANALRIAPGTARNPARQLVPGRGHRFQPAGPA
THTWCDLCGDFIWGVVRKGLQCAHCKFTCHYRCRALVCLDCCGPRDLGWEPALERDTNVD
EHVEWEKPDLSQAEVEQKIKEYNGQINSNLFMSLNKDGSYTGFIKVQLKLARPVSVPSSK
KPPSLQDARRGPARGTAVKRHTSFYLPKDAVKHLHVLSHTRAREVIEALLRKFLVVDDPR
KFALFERAERHGQVYFRKLADDEQPLQLRLLAGPNEKDLSFILKENDSGEVNWDAFSMPE
LHNFLRILQREEEEHLRRILQKYSRCRQKIQEALHACPVG
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgtcggcggaacctgaactcattgagctgcgggagctggcacccgccggccgggccggc
ccgggccgcacccggctggagcgtgccaatgcgctgcgcatcgcgcctggcaccgcgcgc
aaccccgctaggcagctggtccccggccgcggccaccgcttccagcccgcgggcccagcc
acgcacacgtggtgcgacctctgcggcgacttcatctggggcgtcgtgcgcaagggcctg
cagtgcgcgcactgcaagttcacatgccactaccgctgccgcgcgctcgtgtgcctggac
tgctgcgggccccgggacctgggctgggaacccgcgctggagcgggacaccaacgtggac
gagcacgtggagtgggagaagcctgatctttctcaggctgaggttgagcagaagatcaag
gagtacaacggccagatcaacagcaacctcttcatgagcctgaacaaggatggctcctac
accggcttcatcaaggtccagctgaaactggcccggcccgtgtccgtgccctccagcaag
aagcccccgtccttgcaggatgctcgccggggcccagcacggggcacagccgtgaagcgc
cacacctccttctacctgcccaaggacgccgtcaagcacctacacgtgctgtctcacacc
cgggcccgggaggtcatcgaggccctgctccgcaagttcctggtggtggacgacccccgc
aagttcgccctctttgagcgagccgagcgtcatggccaagtctacttccggaagctggcg
gatgacgaacagcccctgcagcttcggctcctggcaggaccgaatgagaaggacttgagc
ttcatcctgaaggaaaatgactccggggaggtgaactgggacgccttcagcatgcccgag
ctgcacaacttcctgcgcatcctgcagcgcgaggaggaggagcacctccgccggatcctg
cagaagtactcccgctgccggcagaagatccaggaggccctgcacgcctgccccgtgggg
tga

DBGET integrated database retrieval system