KEGG   Oryctolagus cuniculus (rabbit): 100340846
Entry
100340846         CDS       T03373                                 

Gene name
PABPC4
Definition
(RefSeq) poly(A) binding protein cytoplasmic 4
  KO
K13126  polyadenylate-binding protein
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03013  RNA transport
ocu03015  mRNA surveillance pathway
ocu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    100340846 (PABPC4)
   03015 mRNA surveillance pathway
    100340846 (PABPC4)
  09123 Folding, sorting and degradation
   03018 RNA degradation
    100340846 (PABPC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100340846 (PABPC4)
   03041 Spliceosome [BR:ocu03041]
    100340846 (PABPC4)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     100340846 (PABPC4)
   mRNA cycle factors
    Stress granule specific factors
     100340846 (PABPC4)
Spliceosome [BR:ocu03041]
 Complex C
  Other components
   Complex C specific factors
    100340846 (PABPC4)
SSDB
Motif
Pfam: RRM_1 PABP RRM_5 RRM_3 ApbA_C
Other DBs
NCBI-GeneID: 100340846
NCBI-ProteinID: XP_002715240
Ensembl: ENSOCUG00000000562
LinkDB
Position
13
AA seq 644 aa
MNAAASSYPMASLYVGDLHSDVTEAMLYEKFSPAGPVLSIRVCRDMITRRSLGYAYVNFQ
QPADAERALDTMNFDVIKGKPIRIMWSQRDPSLRKSGVGNVFIKNLDKSIDNKALYDTFS
AFGNILSCKVVCDENGSKGYAFVHFETQEAADKAIEKMNGMLLNDRKVFVGRFKSRKERE
AELGAKAKEFTNVYIKNFGEEVDDESLKDLFSQFGKTLSVKVMRDPSGKSKGFGFVSYEK
HEDANKAVEEMNGKEIGGKVIFVGRAQKKVERQAELKRKFEQLKQERISRYQGVNLYIKN
LDDTIDDEKLRKEFSPFGSITSAKVMLEDGRSKGFGFVCFSSPEEATKAVTEMNGRIVGS
KPLYVALAQRKEERKAHLTNQYMQRVAGMRALPANAILNQFQPAAGGYFVPAVPQAQGRP
PYYTPNQLAQMRPNPRWQQGGRPQGFQGMPSAIRQAGPRPTLRHLAPTGSECPDRLAMDF
GGAGAAQQGLTDSCQSGGVPTAVQNLAPRAAVAAAAPRAVAPYKYASSVRSPHPAIQPLQ
APQPAVHVQGQEPLTASMLAAAPPQEQKQMLGERLFPLIQTMHSNLAGKITGMLLEIDNS
ELLHMLESPESLRSKVDEAVAVLQAHHAKKEAAQKVGAVAAATS
NT seq 1935 nt   +upstreamnt  +downstreamnt
atgaacgctgcggccagcagctaccccatggcctccctgtacgtgggtgacctgcactcg
gacgtcaccgaggccatgctgtacgaaaagttcagtcctgcggggcctgtgctgtccatc
cgggtctgccgcgatatgatcacccggcgctccctgggttatgcctacgtcaacttccag
cagccagctgacgctgagcgggccttggacaccatgaactttgatgtgattaaggggaag
ccaatccgtatcatgtggtctcagagggatccctctttgagaaaatctggtgtgggaaat
gtcttcatcaagaacctggacaaatctatagataacaaggcactttatgatacgttttct
gcttttggaaacattctgtcctgcaaggtggtgtgtgatgagaacggctctaagggttat
gcctttgtccacttcgagacgcaagaggctgccgacaaggccatcgagaagatgaatggc
atgctcctcaatgaccgcaaagtgtttgtgggcagattcaagtcacgtaaagagcgggaa
gctgagcttggagccaaagccaaggaattcactaatgtttatattaaaaactttggggag
gaggtggatgatgaaagtctgaaagacctatttagtcaatttggtaaaaccctcagtgtc
aaggtgatgagagatcccagtgggaaatccaaaggctttggctttgtgagttacgaaaaa
cacgaggatgccaacaaggccgtagaagagatgaatggaaaagagattggtgggaaagtc
atatttgtaggccgcgcacagaagaaagtagaacggcaagctgaattaaaacggaaattt
gagcagctaaaacaggagcgaattagtcgataccagggtgtgaacctctacattaagaac
ttggatgacaccattgatgatgagaaattacggaaagaattttctccttttgggtcaatc
accagtgctaaggtgatgctggaggatggaagaagcaaaggatttggctttgtctgcttc
tcatctcctgaagaggcaaccaaagcagtcactgagatgaacggacgcattgtgggctcc
aagccactgtacgttgccctagcccagaggaaggaagagagaaaggcccacctgaccaac
cagtatatgcagcgggtggctggaatgagagcactccctgccaacgccatcttaaatcag
ttccagcctgcagctggtggctactttgtgccagcagttccacaggctcagggaagacct
ccttattacacccctaaccagttagcacagatgaggcctaatccacgctggcagcaaggt
gggagacctcaaggcttccaaggaatgccaagtgctattcgccaggctgggcctcgtcca
actcttcgccatctggctccaactgggtctgagtgcccggaccgcttggctatggacttt
ggtggggctggtgccgcccagcaagggctgactgacagctgccagtctggaggtgttcct
acagctgtgcagaatctagcaccccgcgctgctgttgctgctgctgcccctcgggctgtt
gctccatataaatatgcgtccagtgtccgcagccctcaccctgccatacagcctttgcag
gcaccccagcctgctgtccacgtgcaggggcaagagcccctgactgcctccatgctggct
gcagcacccccccaggaacagaaacagatgctgggagaacgattgttcccgctcatccaa
acgatgcactcaaacctggcgggcaagatcacgggaatgctgctggagatcgacaactcg
gagctgctgcacatgctggagtcccccgagtctctccgctccaaggtggatgaagctgtg
gcagttttacaagctcatcatgccaagaaagaagctgcccagaaggtgggcgctgttgct
gctgctacctcttag

KEGG   Oryctolagus cuniculus (rabbit): 100342434
Entry
100342434         CDS       T03373                                 

Gene name
PABPC1
Definition
(RefSeq) poly(A) binding protein cytoplasmic 1
  KO
K13126  polyadenylate-binding protein
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03013  RNA transport
ocu03015  mRNA surveillance pathway
ocu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    100342434 (PABPC1)
   03015 mRNA surveillance pathway
    100342434 (PABPC1)
  09123 Folding, sorting and degradation
   03018 RNA degradation
    100342434 (PABPC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100342434 (PABPC1)
   03041 Spliceosome [BR:ocu03041]
    100342434 (PABPC1)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     100342434 (PABPC1)
   mRNA cycle factors
    Stress granule specific factors
     100342434 (PABPC1)
Spliceosome [BR:ocu03041]
 Complex C
  Other components
   Complex C specific factors
    100342434 (PABPC1)
SSDB
Motif
Pfam: RRM_1 PABP RRM_5 RRM_occluded RRM_3 ATP-grasp_2
Other DBs
NCBI-GeneID: 100342434
NCBI-ProteinID: XP_008254019
Ensembl: ENSOCUG00000004354
UniProt: A0A5F9CN86
LinkDB
Position
3
AA seq 636 aa
MNPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQ
QPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFS
AFGNILSCKVVCDENGSKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKERE
AELGARAKEFTNVYIKNFGEDMDDERLKDLFGKFGPALSVKVMTDESGKSKGFGFVSFER
HEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKFEQMKQDRITRYQGVNLYVKN
LDDGIDDERLRKEFSPFGTITSAKVMMEGGRSKGFGFVCFSSPEEATKAVTEMNGRIVAT
KPLYVALAQRKEERQAHLTNQYMQRMASVRAVPNPVINPYQPAPPSGYFMAAIPQTQNRA
AYYPPSQIAQLRPSPRWTAQGARPHPFQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQ
RVANTSTQTMGPRPAAAAAAATPAVRTVPQYKYAAGVRNPQQHLNAQPQVTMQQPAVHVQ
GQEPLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESP
ESLRSKVDEAVAVLQAHQAKEAAQKAVNSATGVPAV
NT seq 1911 nt   +upstreamnt  +downstreamnt
atgaaccccagcgcccccagctaccccatggcctcgctctacgtgggggacctgcacccc
gacgtgaccgaggcgatgctctacgagaagttcagcccggccgggcccatcctctccatc
cgggtctgcagggacatgatcacccgccgttccttgggctacgcgtatgtgaacttccag
cagccggcggacgcggagcgtgctttggacaccatgaattttgatgtgatcaagggaaag
ccagtacgcatcatgtggtctcagcgtgatccatcccttcgcaaaagtggagtaggcaac
atattcattaaaaatttggacaaatccattgataataaagcactgtatgatacattttct
gcttttggtaacatcctttcttgtaaggtggtttgtgatgaaaatggttccaagggctat
ggatttgtacattttgagacgcaggaggctgctgaaagagctattgaaaaaatgaatggg
atgcttctaaatgatcgcaaagtgtttgttggacgatttaagtctcgtaaagaacgagaa
gcagagctcggagctagggcaaaagagttcaccaatgtttacatcaagaattttggggaa
gacatggatgacgagcgccttaaggatctctttggcaagtttggacctgccttaagtgtg
aaagtaatgactgatgaaagtggaaaatccaaaggatttggatttgtaagctttgagagg
catgaagatgcacagaaagctgtggatgagatgaatggaaaggagctcaatggaaaacaa
atttacgttggtcgagctcagaaaaaagtggaacgccagacggaacttaagcgcaaattt
gagcagatgaagcaagataggatcaccagataccagggtgttaacctttatgtgaaaaat
ctggacgatggtattgatgatgagcggctccgaaaagagttttctccatttggtacaatc
actagtgctaaggttatgatggagggtggtcgaagcaaagggtttggttttgtatgtttc
tcctccccagaagaagccactaaagcagttacagaaatgaacggtagaattgtggccacc
aagcccttgtatgtagctttagctcagcgcaaggaggagcgccaggctcacctcactaac
cagtacatgcagagaatggcgagtgtgcgagctgtgcccaaccccgtgatcaacccttac
cagccagcacctccttcaggttacttcatggcagctatcccacagactcagaaccgtgct
gcatactatcctcctagccaaattgctcaactcagaccaagtcctcgctggactgctcag
ggtgccagacctcatccattccaaaatatgcccggtgctatccgcccagccgctcctaga
ccaccatttagcactatgagaccagcttcttcacaggttccacgggtcatgtccacacag
cgtgttgctaacacatcgacacagacaatgggcccacgtcctgcagctgctgctgctgca
gccactcctgctgtgcgcacggttccacagtacaagtacgctgcaggcgttcgcaatcct
cagcagcatctaaatgcacagccgcaggtgaccatgcagcagcctgctgttcatgtacaa
ggtcaggagcctttgactgcttccatgttggcatctgccccccctcaagagcaaaagcaa
atgttgggtgaacggctgtttcctcttattcaagccatgcaccctactcttgctggtaaa
atcactggcatgttgttggagatcgataattcagaacttcttcatatgcttgagtctcca
gagtctctccgttctaaagtggatgaagctgtagctgtactacaagcccaccaagctaaa
gaggctgcccagaaagcagtgaacagtgccaccggcgttcccgctgtttag

KEGG   Oryctolagus cuniculus (rabbit): 100350595
Entry
100350595         CDS       T03373                                 

Gene name
PABPC5
Definition
(RefSeq) poly(A) binding protein cytoplasmic 5
  KO
K13126  polyadenylate-binding protein
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03013  RNA transport
ocu03015  mRNA surveillance pathway
ocu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    100350595 (PABPC5)
   03015 mRNA surveillance pathway
    100350595 (PABPC5)
  09123 Folding, sorting and degradation
   03018 RNA degradation
    100350595 (PABPC5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100350595 (PABPC5)
   03041 Spliceosome [BR:ocu03041]
    100350595 (PABPC5)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     100350595 (PABPC5)
   mRNA cycle factors
    Stress granule specific factors
     100350595 (PABPC5)
Spliceosome [BR:ocu03041]
 Complex C
  Other components
   Complex C specific factors
    100350595 (PABPC5)
SSDB
Motif
Pfam: RRM_1 RRM_5 RRM_occluded RRM_3 TC1 ClpS
Other DBs
NCBI-GeneID: 100350595
NCBI-ProteinID: XP_017205489
Ensembl: ENSOCUG00000010919
UniProt: G1T092
LinkDB
Position
X
AA seq 382 aa
MGSGEPNPAGKKKKYLKAALYVGDLDPDVTEDMLYKKFRPAGPLRFTRICRDPVTRSPLG
YGYVNFRFPADAEWALNTMNFDLINGKPFRLMWSQPDDRLRKSGVGNIFIKNLDKSIDNR
ALFYLFSAFGNILSCKVVSDDHGSKGYAYVHFDSLAAANRAIWHMNGVRLNNRQVYVGRF
KFPEERAAEVRTRDRATFTNVFVKNFGDDMDDEKLKELFSEYGPTESVKVIRDASGKSKG
FGFVRYETHEAAQKAVLDLHGKSIDGKVLYVGRAQKKIERLAELRRRFERLRLKEKSRPP
GVPIYIKNLDESISDEKLKEEFSSFGSISRAKVMMEVGHGKGFGVVCFSSFEEATKAVDE
MNGRIVGSKPLHVTLGQARRRW
NT seq 1149 nt   +upstreamnt  +downstreamnt
atggggagcggggagccgaatcctgctggcaagaaaaagaaatacctcaaggccgccctg
tatgtaggtgacttggacccagatgtcaccgaggacatgctgtataagaagttcaggcct
gctggccctctgcgcttcacccgcatctgccgtgacccggtgacccgcagccccctgggc
tatggctatgttaacttccgctttccggcggatgccgagtgggccttgaacaccatgaat
tttgatttgattaacggcaaacccttccgcctcatgtggtcacagccagatgaccgctta
aggaagtctggagttggaaatatattcatcaaaaacctggacaaatccatagacaatagg
gccctgttttacttattttctgcttttgggaacattctctcctgcaaagtggtaagcgat
gaccacggctctaagggctatgcctatgtgcattttgacagcctggctgctgccaacagg
gccatctggcacatgaatggagtgcggctcaacaaccgccaggtgtatgttggcagattc
aaattcccggaagagcgggcagctgaagtcagaaccagggatagagcaactttcacgaat
gttttcgttaaaaactttggcgatgacatggatgacgaaaaactgaaggaactgttcagc
gaatacgggccaaccgaaagtgtcaaggtaatcagagatgccagtgggaaatcgaaaggc
tttggatttgtgagatatgagacacatgaggctgcccaaaaggctgtgctagacctgcat
ggaaagtccatcgatgggaaagtcctatacgtagggcgagcgcagaagaaaatcgaacgc
ctggctgagttaaggcggagatttgagaggctaagattaaaagaaaaaagccgccctcca
ggggtgcctatctatattaagaacctcgatgagagcatcagtgatgagaaactgaaggag
gaattttcttcctttggatcaattagccgggccaaagtgatgatggaagtggggcatggc
aaagggtttggtgttgtgtgcttctcctcttttgaagaggcaaccaaagcagtggatgag
atgaatggtcgcatagtgggttccaagcccttgcatgtcaccctgggccaggccagacgc
aggtggtga

KEGG   Oryctolagus cuniculus (rabbit): 100351201
Entry
100351201         CDS       T03373                                 

Gene name
PABPC1L
Definition
(RefSeq) poly(A) binding protein cytoplasmic 1 like
  KO
K13126  polyadenylate-binding protein
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03013  RNA transport
ocu03015  mRNA surveillance pathway
ocu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    100351201 (PABPC1L)
   03015 mRNA surveillance pathway
    100351201 (PABPC1L)
  09123 Folding, sorting and degradation
   03018 RNA degradation
    100351201 (PABPC1L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100351201 (PABPC1L)
   03041 Spliceosome [BR:ocu03041]
    100351201 (PABPC1L)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     100351201 (PABPC1L)
   mRNA cycle factors
    Stress granule specific factors
     100351201 (PABPC1L)
Spliceosome [BR:ocu03041]
 Complex C
  Other components
   Complex C specific factors
    100351201 (PABPC1L)
SSDB
Motif
Pfam: RRM_1 PABP RRM_5 RRM_7 Limkain-b1
Other DBs
NCBI-GeneID: 100351201
NCBI-ProteinID: XP_017206226
Ensembl: ENSOCUG00000003005
LinkDB
Position
Un
AA seq 612 aa
MNAGGSGYPLASLYVGDLHPDVTEAMLYDTFSPAGPILSIRVCRDVATRRSLGYAYINFQ
QPADAERALDTMNFEVIKGQPIRIMWSQRDPGLRKSGVGNVFIKNLEDSIDNKALYDTFS
TFGNILSCKVVCDEHGSRGFGFVHFETHEAAQQAIRTMNGMLLNDRKVFVGHFKSRRERE
AELGARALEFTNIYVKNLRADVDERCLQDLFSQFGKMLSVKVMRDSSGHSRGFGFVNFEK
HEEAQKAVDHMNGKEVSGRLLYVGRAQKRAERQNELKRKFEQVKQDRLHRYQGVNLYVKN
LDDSIDDEKLRKEFSPYGVITSAKVMTEGGHSKGFGFVCFSSPEEATKAVTEMNGRIVGT
KPLYVALAQRKEERKAILTNQLLPRLLPXXRRFSPPSCTALHPRSRSPLQPPAQAAYAGS
GAVAPIQPAPRWSAQPPQPSSASTVRPPGVPRRPRDHISSARQASTQVARPVPPTQRVAN
IGTQTTGPSGTGCPIAGRPLLPYRCPSGGHHSQPMLQEPAVHVPGQEPLTASMLAAAPLH
EQKQMIGERLYPLIHNVHKQLAAKITGMLLEIDNSELLLMLESPESLHAKIEEAVAVLQA
HQAAEQPKVFTH
NT seq 1839 nt   +upstreamnt  +downstreamnt
atgaacgccggcggctcgggttacccactcgcctcgctctacgtgggcgacctgcacccc
gatgtgactgaggccatgctctacgacaccttctcgcccgccggccccatcctgtccatc
cgcgtgtgccgcgacgtggccacccggcgctcgctgggctatgcctacatcaacttccag
cagccggccgacgcggagcgcgccctggacaccatgaacttcgaggtgatcaagggccag
cccatccgcatcatgtggtcccagcgagacccggggctgcgcaagtcaggcgtgggcaac
gtcttcatcaagaacctggaggactccatcgacaacaaggctctgtatgacaccttctcc
accttcgggaacatcctctcttgcaaggtggtgtgcgacgagcacggctcccggggcttc
ggcttcgtgcactttgagacccacgaggctgcgcagcaggccatccgcaccatgaacggg
atgctgctcaatgaccgcaaagtcttcgtcggccacttcaagtcccgccgggagcgggag
gcggagctgggggcacgggccctggagttcaccaacatctacgtgaagaacctccgggca
gacgtggatgagcggtgcctgcaggacctcttctcccagtttggaaagatgctgagtgtg
aaggtgatgagggacagcagcggccactcccggggctttggcttcgtcaactttgagaag
cacgaggaagcgcagaaggctgtggaccacatgaacgggaaggaggtgagcgggcggctg
ctgtacgtgggccgcgcccagaagcgggcggagcggcagaatgagctgaagcgcaagttc
gagcaggtgaagcaggaccggctgcaccgctaccagggcgtgaacctgtatgtgaagaac
ctggatgactctatcgatgatgagaaactgaggaaagagttctctccctacggagtgatc
accagtgcaaaggtgatgacagagggtggccacagcaaggggtttggctttgtgtgtttt
tcctctccagaggaggcgacaaaggccgtgacggagatgaacgggcgcatcgtgggcacc
aagccactgtatgtggcgctggcgcagcgcaaggaggagcggaaggccatcctgaccaac
cagctcctgccccgtctcctcccctgatgacgccgtttctcacctcccagctgcacagcc
cttcatcctaggtcccgttctcccctgcagcctccagcgcaggcggcgtatgctggctct
ggcgccgtggcacccatccagcctgcccccaggtggtcggcccagcctccacaaccttcg
tctgcctccaccgtgcggccaccaggtgtgcctcggcgcccccgggaccacatcagcagt
gccaggcaggcctccacccaggtggcacggccggtgcctcccacccaaagagtggccaac
attggtacccagaccacaggacccagcgggacgggatgccctatcgcaggccggcctctc
ctgccgtaccgatgcccttcagggggccaccacagccagcctatgctccaggagcccgct
gtgcacgtccccggccaggagcccctgactgcgtccatgctggctgcggcgcccctgcac
gagcagaagcagatgattggggagcgtctctaccccctcatccacaacgtccacaagcag
ctggctgccaagatcacgggcatgctgctggagattgacaactcggagctgctgctcatg
ctggagtctccggagtccctccacgccaagatagaagaggcggtggcagtgttgcaggcc
caccaggccgcggagcagcccaaggtgttcacgcactga

KEGG   Oryctolagus cuniculus (rabbit): 100353191
Entry
100353191         CDS       T03373                                 

Gene name
PABPC4L
Definition
(RefSeq) poly(A) binding protein cytoplasmic 4 like
  KO
K13126  polyadenylate-binding protein
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03013  RNA transport
ocu03015  mRNA surveillance pathway
ocu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    100353191 (PABPC4L)
   03015 mRNA surveillance pathway
    100353191 (PABPC4L)
  09123 Folding, sorting and degradation
   03018 RNA degradation
    100353191 (PABPC4L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100353191 (PABPC4L)
   03041 Spliceosome [BR:ocu03041]
    100353191 (PABPC4L)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     100353191 (PABPC4L)
   mRNA cycle factors
    Stress granule specific factors
     100353191 (PABPC4L)
Spliceosome [BR:ocu03041]
 Complex C
  Other components
   Complex C specific factors
    100353191 (PABPC4L)
SSDB
Motif
Pfam: RRM_1 RRM_5 RRM_7 Limkain-b1 RRM_occluded RRM_3
Other DBs
NCBI-GeneID: 100353191
NCBI-ProteinID: XP_002716993
UniProt: A0A5F9C3X8
LinkDB
Position
15
AA seq 370 aa
MNVAAKYRMASLYVGDLHSDVTEDLLFKKFSRVGPVLSIRICRDLVTRRSLGYAYVNFLQ
LADAQKALDTMNFDVVKGKAIRLMWSQRDAYLRKSGIGNVFIKNLDKSIDNKSLYECFSA
FGKILSSKVMSDDRGSKGYAFVHFQSQSAADRAIEEMNGKFLKDCKVFVGRFKSRKDREA
ELRNKASEFTNVYIKNFGDDMDDERLREVFSTYGRILSVKVMTNSCGKSRGFGFVSFDSH
EAARKAVEEMNGKEVNGQPIFVGRAQKKVERQAELKQMFEQLKKERIRGCQGAKLYIKNL
DENIDDEKLRKEFSSFGSISRVKVMQEEGQSKGFGLICFSSSEDAARAMTVMNGRILGSK
PLNIALAQGY
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgaatgtggcagccaagtaccgcatggcctccctctatgtgggcgacctccattccgat
gtcaccgaggacctgctgttcaagaagttcagcagggtggggcccgtgttgtccatccgc
atctgcagggacctggtgacccgccgctctctgggctatgcctacgtcaacttcctgcag
ctggccgatgcccagaaggccctggacacaatgaactttgatgtggtgaaaggcaaggcc
atccgactcatgtggtcccaacgggacgcctacttgaggaaatctggaatcgggaacgtc
ttcatcaagaatctggacaagtccatagacaacaaaagcctttatgaatgtttttcagct
tttggaaagatcctttcttccaaggtgatgagtgatgaccggggctccaagggttatgcg
ttcgtgcacttccagagccagagcgccgcagacagggccatcgaggagatgaacgggaag
ttcctcaaggactgcaaggtgtttgtgggcagattcaaaagccgcaaagatcgggaagcc
gagctcagaaacaaagccagtgaattcaccaatgtctacatcaaaaacttcggggacgac
atggatgatgagaggctgcgggaagtcttcagtacctacggcagaattctcagtgttaag
gtgatgaccaactcctgtgggaaatccagaggctttggctttgtgagttttgacagccac
gaggccgccagaaaggccgtggaagaaatgaacggcaaggaagtaaacgggcagcccatt
tttgtaggtcgggcacagaagaaggtagagcggcaggctgagttaaagcaaatgtttgaa
cagttgaaaaaggaaagaatccgcgggtgccagggggcgaaactctacattaagaacctt
gatgagaacattgatgatgaaaaactccgaaaggagttttcttcctttgggtccattagc
agagttaaggtgatgcaggaagaaggacaaagcaaaggtttcggcttgatctgcttctcc
tcttctgaggatgccgctagagcaatgactgtgatgaatggtcgcatcttgggctccaaa
cctctcaacatcgctttggcccaggggtactag

KEGG   Oryctolagus cuniculus (rabbit): 100356494
Entry
100356494         CDS       T03373                                 

Gene name
PABPC1L2B
Definition
(RefSeq) poly(A) binding protein cytoplasmic 1 like 2B
  KO
K13126  polyadenylate-binding protein
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03013  RNA transport
ocu03015  mRNA surveillance pathway
ocu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    100356494 (PABPC1L2B)
   03015 mRNA surveillance pathway
    100356494 (PABPC1L2B)
  09123 Folding, sorting and degradation
   03018 RNA degradation
    100356494 (PABPC1L2B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100356494 (PABPC1L2B)
   03041 Spliceosome [BR:ocu03041]
    100356494 (PABPC1L2B)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     100356494 (PABPC1L2B)
   mRNA cycle factors
    Stress granule specific factors
     100356494 (PABPC1L2B)
Spliceosome [BR:ocu03041]
 Complex C
  Other components
   Complex C specific factors
    100356494 (PABPC1L2B)
SSDB
Motif
Pfam: RRM_1 RRM_5 Nup35_RRM
Other DBs
NCBI-GeneID: 100356494
NCBI-ProteinID: XP_017205498
Ensembl: ENSOCUG00000002565
LinkDB
Position
X
AA seq 250 aa
MRDADADADADADEEVAAAVAAAAAAAAAAAAADADAETGGGSEGNPDFPMASLYVGDLH
PEVTEAMLYEKFSPAGPILSIRICRDKITRRSLGYAYVNYQQPVDAKRALETLNFDVIKG
RPVRIMWSQRDPSLRKSGVGNVFIKNLGKTIDNKALYNIFSAFGNILSCKVACDEKGPKG
YGFVHFQKQESAERAIDAMNGMFLNYRKIFVGRFKSHKEREAERGAWARQSTSADVKDFE
EDTDEEATLR
NT seq 753 nt   +upstreamnt  +downstreamnt
atgcgggatgcggatgcggatgcggacgcagatgcggacgaggaggtagcggcggccgta
gcggcggcggcggcggcggcggcggccgccgctgccgcagatgcagatgcggagacgggc
gggggctcggaggggaacccagactttcccatggcctcgctgtacgtgggcgatctgcac
cccgaagtgaccgaggcaatgctctacgagaagttcagcccagccgggcccattctctcc
atccgcatctgcagagacaagatcacccgccgctctttgggctacgcgtatgtcaactac
cagcaaccggtggacgccaagcgggccctggagaccctgaatttcgatgtcataaagggc
aggccggtgcgcatcatgtggtcccagagggacccctcgctccgcaagagcggggtgggc
aacgtcttcatcaagaacctgggcaagaccattgacaacaaggcgttgtacaacatcttc
tcagccttcggcaacatcctctcctgcaaagtggcctgcgacgaaaaggggcccaagggc
tatgggttcgtgcacttccagaagcaggagtcggccgaaagggccatagatgcaatgaat
ggcatgttccttaactaccgcaaaattttcgtcggcagattcaagtcccacaaagagcga
gaggccgaaaggggagcctgggccaggcagtccaccagtgctgacgtcaaggatttcgag
gaagacaccgatgaggaggccaccttgcgataa

DBGET integrated database retrieval system