KEGG   Oryctolagus cuniculus (rabbit): 100340945Help
Entry
100340945         CDS       T03373                                 

Gene name
HK1
Definition
(RefSeq) hexokinase 1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00010  Glycolysis / Gluconeogenesis
ocu00051  Fructose and mannose metabolism
ocu00052  Galactose metabolism
ocu00500  Starch and sucrose metabolism
ocu00520  Amino sugar and nucleotide sugar metabolism
ocu00524  Neomycin, kanamycin and gentamicin biosynthesis
ocu01100  Metabolic pathways
ocu01200  Carbon metabolism
ocu04066  HIF-1 signaling pathway
ocu04910  Insulin signaling pathway
ocu04930  Type II diabetes mellitus
ocu04973  Carbohydrate digestion and absorption
ocu05230  Central carbon metabolism in cancer
Module
ocu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ocu_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ocu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100340945 (HK1)
   00051 Fructose and mannose metabolism
    100340945 (HK1)
   00052 Galactose metabolism
    100340945 (HK1)
   00500 Starch and sucrose metabolism
    100340945 (HK1)
   00520 Amino sugar and nucleotide sugar metabolism
    100340945 (HK1)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    100340945 (HK1)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    100340945 (HK1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100340945 (HK1)
  Digestive system
   04973 Carbohydrate digestion and absorption
    100340945 (HK1)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    100340945 (HK1)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100340945 (HK1)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     100340945 (HK1)
Membrane trafficking [BR:ocu04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    100340945 (HK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD
Motif
Other DBs
NCBI-GeneID: 100340945
NCBI-ProteinID: XP_008268244
Ensembl: ENSOCUG00000006697
UniProt: G1SRI8
LinkDB All DBs
Position
18
AA seq 921 aa AA seqDB search
MGQNCQRTQATEPKMVIQPPLTEKKIDKYLYAMRLSDETLVDIMTRFKKEMKNGLSRDFN
PTATVKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKKQNVHMESEAYETPE
NIVHGSGSQLFDHVAECLGDFMEKRNIKDKKLPVGFTFSFPCRQSKIDEAVLITWTKRFK
ASGVEGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQQCEVGLIIGTGTNA
CYMEELRHIDLVEGDEGRMCINTEWGAFGDDGALEDIRTEFDREIDRGSLNPGKQLFEKM
VSGMYMGELVRLILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGLHNAKEIL
TRLGVEPSDDDCISVQHVCTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGSL
YKTHPQYSRRFHKTLRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETLAH
FRLTKEMLLEVKKRMRTEMEAGLRRQTHDKAVVKMLPSFVRSTPDGTENGDFLALDLGGT
NFRVLLVKIRSGKKRTVEMHNKIYAIPLEIMQGTGEELFDHIVSCISDFLDYMGIKGPRM
PLGFTFSFPCKQTSLDAGILVTWTKGFKATDCVGHDVATLLRDAIKRREEFDLDVVAMVN
DTVGTMMTCAYEEPTCEVGLIVGTGCNACYMEEMRNVEMLEGNEGQMCINMEWGAFGDNG
CLDDIRTIYDRLVDEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRGQVSEPL
KTRGIFETKFLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSRRAAQLCGA
GMAAVVDKIRENRGLDHLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCNVSFLLSEDG
SGKGAALITAVGVRLRGELSS
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
atggggcagaactgccagcgaacacaggctacagaacctaaaatggtgatacagccccca
cttactgaaaagaagattgacaagtatctctacgccatgcggctctccgatgaaactttg
gtagatatcatgactcgcttcaagaaggagatgaagaatggcctctcccgggattttaac
ccaacagccacagtcaagatgttgccaacgtttgtaaggtccattcctgatggttccgaa
aagggagatttcatcgccctggatctcggggggtcttcctttcggattctgcgggtgcaa
gtgaatcacgagaagaagcagaatgtccacatggagtccgaggcctacgaaacccccgag
aacatcgtgcatggcagcgggagccagcttttcgatcatgtcgccgaatgcctgggagac
ttcatggagaaaaggaacatcaaggacaagaaactgcccgtgggattcaccttctcgttc
ccttgccgacaatcaaaaatagacgaggctgtcctgatcacctggacaaagcgattcaag
gcgagcggcgtggaaggggcagatgtggtcaagctgctgaacaaagccatcaaaaagcga
ggggactatgacgccaacatcgtggctgtggtgaacgacacggtggggaccatgatgacc
tgtggctacgacgaccagcagtgtgaagtcggcctgattattggcactggcaccaacgcg
tgctacatggaggagctgaggcacatcgacctggtggagggcgacgagggcaggatgtgc
atcaacacggagtggggggccttcggcgacgacggcgccctggaagacatccgcactgag
tttgacagggagatcgaccggggctcgctcaacccggggaagcagctgtttgagaagatg
gtcagcggcatgtacatgggggagctggtccggctgatcctggtcaagatggccaaggag
ggcctcttgtttgaagggcgaatcaccccagagctgctcacccgagggaagttcaacacc
agcgacgtgtcagccatcgaaaagaataaggaaggcctccacaacgccaaagagatcctg
acccgcctgggagtggagccgtccgacgatgactgtatttccgttcagcacgtgtgcacc
attgtctcgttccgctcggccaacctggtggctgccacgctgggcgccatcttgaaccgc
ctgcgggacaacaagggcacgccccggctacgcaccaccgtcggtgtcgacggctctctg
tacaagacacacccacagtattcccggcgtttccacaagaccctgaggcgcctggtgcct
gactccgacgtgcgcttcctgctgtcggagagtggcagcggcaagggggccgccatggtg
acggcggtggcctaccgcctggctgagcagcaccggcagatagaggagaccctggcccac
ttccgcctcaccaaggagatgctgctggaggtgaagaagaggatgcggaccgagatggag
gcggggctgaggaggcagacgcacgacaaggctgtggtcaagatgctgccctccttcgtc
cgcagcacccccgacggcaccgagaacggtgacttcttggccctggatctcggaggaacg
aacttccgcgtcctgctggtgaaaatccgaagcgggaagaagcgcacggtggagatgcat
aacaagatctatgccatccctctggagatcatgcagggcaccggggaagagctgttcgac
cacatcgtctcctgcatctccgacttcctggactacatggggatcaagggcccgcggatg
ccgctgggcttcacattctcgttcccctgcaagcagacgagtctggacgcgggaatcctg
gtcacctggaccaaaggcttcaaggcgactgactgcgtgggccatgacgtagccacttta
ctgagggacgccatcaaaaggagagaggaatttgacctggatgtggtggccatggtcaat
gacacggtgggcaccatgatgacctgtgcctacgaggagcccacctgcgaggttggactt
attgtagggacgggctgcaatgcctgctacatggaggagatgaggaacgtggagatgctg
gaggggaatgaggggcagatgtgcatcaacatggagtggggcgcctttggcgacaacggc
tgtctggatgacatcagaaccatctacgaccgactggtggacgaatattctctaaacgct
gggaagcagaggtacgagaagatgatcagcggcatgtacctgggggagatcgtccgcaac
atcctcatcgacttcaccaagaagggcttcctcttccgcgggcaggtctccgagccgctc
aagacgaggggcatctttgagaccaagttcctctctcagatcgagagcgaccggctggcg
ctgctccaggtgcgggccatcctccagcagctgggtctgaacagcacgtgtgacgacagc
atcctcgtcaagaccgtgtgcggggtggtgtccaggagggccgcgcagctgtgcggcgca
ggcatggctgcggtggtggacaagatccgcgagaacagagggctggaccatctcaacgtg
accgtgggcgtggatgggacactgtacaagcttcatccacacttctccagaatcatgcat
cagaccgtgaaggagctgtccccaaagtgtaacgtgtccttcctcctgtccgaagacggt
agcggtaaaggcgccgcgctcatcacggctgtgggcgtgaggctccgaggcgaactgagc
agctag

DBGET integrated database retrieval system