KEGG   Oryctolagus cuniculus (rabbit): 100340952
Entry
100340952         CDS       T03373                                 

Gene name
ELK1
Definition
(RefSeq) ELK1, ETS transcription factor
  KO
K04375  ETS domain-containing protein Elk-1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04012  ErbB signaling pathway
ocu04014  Ras signaling pathway
ocu04510  Focal adhesion
ocu04910  Insulin signaling pathway
ocu04912  GnRH signaling pathway
ocu04921  Oxytocin signaling pathway
ocu05140  Leishmaniasis
ocu05161  Hepatitis B
ocu05163  Human cytomegalovirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05213  Endometrial cancer
ocu05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100340952 (ELK1)
   04012 ErbB signaling pathway
    100340952 (ELK1)
   04014 Ras signaling pathway
    100340952 (ELK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100340952 (ELK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100340952 (ELK1)
   04912 GnRH signaling pathway
    100340952 (ELK1)
   04921 Oxytocin signaling pathway
    100340952 (ELK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100340952 (ELK1)
   05205 Proteoglycans in cancer
    100340952 (ELK1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100340952 (ELK1)
   05213 Endometrial cancer
    100340952 (ELK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100340952 (ELK1)
   05161 Hepatitis B
    100340952 (ELK1)
   05163 Human cytomegalovirus infection
    100340952 (ELK1)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100340952 (ELK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    100340952 (ELK1)
Transcription factors [BR:ocu03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    100340952 (ELK1)
SSDB
Motif
Pfam: Ets
Other DBs
NCBI-GeneID: 100340952
NCBI-ProteinID: XP_002719932
Ensembl: ENSOCUG00000010521
UniProt: G1SZG6
LinkDB
Position
X
AA seq 432 aa
MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKL
SRALRYYYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCPSQPEVSVASAVANVAPAAVH
ATPGDTACGKPGTPKGAGMAGPGGLARSSRNEYMRSGLYSTFTIQSLQPQPQPPPPSHLR
SASVLPSTTPGGASAPPSGSRSTSPTPLEACLEAEEAGLPLQVILTPPEVPNVKSEELDV
EPALGRPLPPEVKVDGPKEELEGAGEAGFVPETTKAEPEVPPTEGGPARLPAVVRETAAP
AGGLATSSPEIAQPQKGRKPRDLELPLSPSLLGGPGPDRTPGSGTGSGLQAPGPALTPSL
LPTHTLTPVLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSSGSAQVHIPSISVDGLS
TPVVLSPGPQKP
NT seq 1299 nt   +upstreamnt  +downstreamnt
atggacccatctgtgacgctgtggcagtttctgctgcagctgctgagagagcaaggcaat
ggccacatcatctcctggacctcacgggatggtggtgagttcaagctggtggatgcagag
gaggtagcccggctgtgggggctgcgcaagaacaagaccaacatgaattatgacaagctc
agccgggccttgcggtactactatgacaagaatatcatccgcaaggtgagcggccagaag
tttgtctacaagttcgtgtcctatcccgaggtcgcagggtgctccaccgaagactgcccg
tcccagcctgaggtgtctgttgcctctgccgtggcaaatgtggcccctgctgctgtacat
gccacccctggggacaccgcctgtggaaagccaggcacacccaagggtgcagggatggca
ggcccaggtggtttggcacgcagcagccggaacgagtacatgcgctccggtctctactct
accttcaccattcagtctctgcagccacagccacagccaccgccaccatctcatctccga
tctgcctccgtgctccccagcaccacccctggaggagcatcagcgcccccctccggcagc
aggagcactagtccaacccccttggaggcctgcctagaggctgaggaggctggcctgcct
ctgcaggtcatcttaaccccgcccgaggtcccgaacgtgaaatcggaagagctcgacgtg
gagcctgctttgggccggccactgcccccagaagtcaaagtggatgggcccaaggaagag
ttggaaggcgcgggggaggcagggtttgtgccggaaaccaccaaggctgagccggaagtc
cctcccacagaaggcgggccggcccggctgcccgcggtcgttagggagactgcggcgccg
gcgggtggcctggcgacttctagccctgaaattgcccagccgcagaagggccggaagccg
cgggacctggagcttccactcagcccaagcctgcttggtgggccgggacccgaccggacc
ccaggctctggaactggctctggtctgcaggcaccggggccagcgctgacgccttctttg
ctacctactcatacattgaccccggtgctgctgactcccagctcgctgcctcccagcatt
cacttctggagcaccctgagtcccattgcaccccgtagcccggccaagctctccttccag
tttccttccagcggcagcgcccaggtgcacatcccttccatcagcgtggatggcctctcg
acccccgtggtgctctccccagggcctcagaagccatga

DBGET integrated database retrieval system