KEGG   Oryctolagus cuniculus (rabbit): 100340979Help
Entry
100340979         CDS       T03373                                 

Gene name
LIG1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03030  DNA replication
ocu03410  Base excision repair
ocu03420  Nucleotide excision repair
ocu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    100340979 (LIG1)
   03410 Base excision repair
    100340979 (LIG1)
   03420 Nucleotide excision repair
    100340979 (LIG1)
   03430 Mismatch repair
    100340979 (LIG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ocu03032]
    100340979 (LIG1)
   03400 DNA repair and recombination proteins [BR:ocu03400]
    100340979 (LIG1)
Enzymes [BR:ocu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     100340979 (LIG1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     100340979 (LIG1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     100340979 (LIG1)
DNA replication proteins [BR:ocu03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    100340979 (LIG1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     100340979 (LIG1)
DNA repair and recombination proteins [BR:ocu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     100340979 (LIG1)
   NER (nucleotide excision repair)
    Other NER factors
     100340979 (LIG1)
   MMR (mismatch excision repair)
    Other MMR factors
     100340979 (LIG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 100340979
NCBI-ProteinID: XP_002723865
Ensembl: ENSOCUG00000011841
LinkDB All DBs
Position
Un
AA seq 915 aa AA seqDB search
MQRSIMSFFYPTKEGKTKKPEKETSHSGREAEPPPKVALKERNGVVAGSDSPVKRPGRKV
ARVLSSEGEEEDEALSPPRSQKSGPERPQDSPPSPAASPENTPCPSDSSPVGLATAGIPK
RLTARKQLPKRTIQDVLGGQDEDKDREAKRKKKEEETETPRESPTEAEVAEKKDAEEGPR
PMTPPEPPESPKEAPVGSSSEPQVAVKQEPQEDQAKPPARAPRTLSSFFTPRKPAIKAEV
KEEDPAIVRKEEARGALDPVSYNPAKSNYHPVEDACWKPGQKVPYLAVARTFEKIEEVSA
RLRMVETLSNFLRSVVALSPPDLLPILYLSLNRLGPPQQGLELGVGDGVLLKAVAQATGR
QLDIVRAEAAESGDVGLVAEYSRVTQRFMLPPPPLTASGVFAKFRDIARLTGSASMTKKM
DIIKGLFVACRHSEARFIARALRGRLRLGLAEQSVLTALTQAVSLTPPGQAFPPAVVDAG
KGKTAEARKTWLEEQGMVLKQTFCEVPDLDRIIPVLLEHGLERLPEHCKLSPGTPLRPML
AHPTRGVSEVLKRFEEAAFTCEYKYDGQRAQIHALEGGEVKIFSRNQEDNTGKYPDIISR
IPKIKLPSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKDVDPSEIQVQVCLYAFDLIY
LNGQSLVREPLSRRRQLLRENFVETEGEFLFATSLDTKDLEQIAEFLEQSVKDSCEGLMV
KTLDVDATYEIAKRSHNWLKLKKDYLDGVGDTLDLVVIGAYLGRGKRAGRYGGFLLACYD
EDTEGLQAICKLGTGFSDEELEEQHQSLQALVLPAPRPYVQAGGAVAPDHWLDPTTVWEV
KCADLSLSPIYPAARGLVDKEKGISLRFPRFVRVRKDKMPEEATTGAEVADLYWRQSQIQ
NQQYEDSDTDLEDFF
NT seq 2748 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgaagcatcatgtcatttttttaccccacaaaagaggggaagacgaagaagcct
gagaaggagacgtcccacagcggcagagaggcagagccaccacccaaggtggcgctgaag
gagcgcaatggcgtggtggctgggagcgactctccagtgaagaggcctgggaggaaggtg
gcccgcgtcctgagcagcgaaggggaggaggaggacgaagccctcagcccgcccaggagc
cagaagtctggtccagagcgcccacaggactccccgcccagccctgccgcatcacctgag
aacaccccttgcccctccgactcctcccccgtgggcctggccacggccggcatcccaaag
cgcctcacagctcggaagcagctcccgaaacggacaattcaggatgtcctgggaggacag
gatgaggacaaggaccgggaagccaagaggaagaagaaggaggaagaaacagagaccccg
agagaaagccccaccgaggctgaagtggcagagaagaaggacgcagaggaggggccccgg
cctatgacgccccctgagccccctgagtcccccaaagaggccccggtgggaagcagctca
gagccccaggtggccgtgaagcaggagccacaggaggaccaggccaagccccctgcccgc
gccccccggacactcagcagtttcttcactccccggaagccggccatcaaagcagaagtg
aaggaagaagacccagccattgtgaggaaggaggaggccagaggagccctggacccagtg
agctataaccctgccaagagcaactaccaccctgtggaagacgcctgctggaaacccggc
cagaaggtcccttatctggccgtggcccggacgtttgagaagatcgaggaggtctctgct
cggctccggatggtggagacgctgagcaactttctgcgctctgtggtagccctgtcgcca
ccagacctcctccccatcctctacctcagcctcaaccgcctagggccgccccagcagggc
ctggagctcggtgttggggacggcgtcctcctcaaggcggtggcccaggccacaggtcgg
cagctggacattgtccgggctgaagcggccgagtcgggtgacgtggggctggtggcggag
tacagccgcgtcacccagaggttcatgctgccaccgccccctctcaccgcctccggggtc
ttcgccaagtttcgggacatcgcccggctcactggcagcgcttccatgaccaagaagatg
gacatcatcaaaggcctctttgttgcttgccgacactcagaagcccgattcatcgccagg
gccctgagggggcggctgcgcctcgggctggcagagcagtcggtgctgacggccctcacc
caggctgtgagcctcacaccccctggccaagcattcccccccgccgtggtggacgctggg
aagggcaagacggcagaggccaggaagacgtggctggaggagcagggcatggtgctgaag
cagacgttctgcgaggtgcccgacctggaccggatcatcccagtgctgctggagcacggg
ctggagcggctcccggaacactgcaagctgagcccaggcacccccttgaggccaatgctg
gcccaccccacccggggcgtcagcgaggtcctgaagcgctttgaggaggcagctttcacc
tgcgagtacaagtacgacgggcagagggcacagatccatgctctggaaggcggggaggtg
aagatcttcagcaggaaccaggaggacaacactgggaagtaccctgacatcatcagccgc
atccccaagattaagctcccgtcagtcacatccttcatcctggacaccgaggccgtggcc
tgggatcgggagaagaagcagatccagccattccaggtgctcaccacccgcaaacgcaag
gatgtagacccatcggagatccaggtgcaggtgtgtctgtacgccttcgacctcatctac
ctcaacggacagtccttggtgcgcgagcccctgtcccgccgccggcagctgctccgcgag
aacttcgtggagacagagggcgagtttctgttcgccacctccctggacaccaaggacctc
gagcagatcgccgagttcctggagcagtcggtgaaagactcctgcgaggggctgatggtg
aagaccctggacgtggacgccacctacgagatcgccaagagatcgcacaactggctcaag
ctgaagaaggactacctggacggcgtgggcgacaccctggacctcgtggtgattggcgcc
tacctgggccgggggaagcgtgccggccgctacgggggctttctgctggcctgctacgac
gaagacaccgagggactgcaggccatctgcaagctggggaccggcttcagcgacgaggag
ctggaggagcagcaccagagcctccaggccctggtgctgcccgcgccccgcccctatgtg
caggccggtggtgccgtggcacctgaccactggctggaccccaccaccgtgtgggaggtg
aagtgtgcggatctctccctctctcccatctaccctgctgcccgtggcctggtggacaag
gagaaggggatctcccttcgcttccctcgctttgttcgcgtccggaaagacaagatgccg
gaagaggccaccaccggtgctgaggtggccgatctgtactggaggcagagtcagattcag
aaccaacagtacgaggactcggacaccgacttggaagatttcttctga

DBGET integrated database retrieval system