KEGG   Oryctolagus cuniculus (rabbit): 100341050
Entry
100341050         CDS       T03373                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01524  Platinum drug resistance
ocu04115  p53 signaling pathway
ocu04210  Apoptosis
ocu04215  Apoptosis - multiple species
ocu04932  Non-alcoholic fatty liver disease
ocu05010  Alzheimer disease
ocu05012  Parkinson disease
ocu05014  Amyotrophic lateral sclerosis
ocu05016  Huntington disease
ocu05017  Spinocerebellar ataxia
ocu05020  Prion disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05132  Salmonella infection
ocu05134  Legionellosis
ocu05145  Toxoplasmosis
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
ocu05210  Colorectal cancer
ocu05222  Small cell lung cancer
ocu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100341050
   04215 Apoptosis - multiple species
    100341050
   04115 p53 signaling pathway
    100341050
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100341050
  09162 Cancer: specific types
   05210 Colorectal cancer
    100341050
   05222 Small cell lung cancer
    100341050
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100341050
   05012 Parkinson disease
    100341050
   05014 Amyotrophic lateral sclerosis
    100341050
   05016 Huntington disease
    100341050
   05017 Spinocerebellar ataxia
    100341050
   05020 Prion disease
    100341050
   05022 Pathways of neurodegeneration - multiple diseases
    100341050
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100341050
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100341050
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100341050
   05134 Legionellosis
    100341050
   05152 Tuberculosis
    100341050
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100341050
   05162 Measles
    100341050
   05164 Influenza A
    100341050
   05161 Hepatitis B
    100341050
   05160 Hepatitis C
    100341050
   05168 Herpes simplex virus 1 infection
    100341050
   05163 Human cytomegalovirus infection
    100341050
   05167 Kaposi sarcoma-associated herpesvirus infection
    100341050
   05169 Epstein-Barr virus infection
    100341050
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100341050
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100341050
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 DUF3365
Other DBs
NCBI-GeneID: 100341050
NCBI-ProteinID: XP_017205526
Ensembl: ENSOCUG00000021237
UniProt: G1TUQ7
LinkDB
Position
Un
AA seq 105 aa
MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGWKTGQAVGFSCTDANKNKGITW
GEDTLMEYLENPKKYIPGTKMIFAGIKKKNERSDLIAYLKKATNE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggtgatgttgagaaaggcaagaagatttttgttcagaaatgtgcccagtgccacact
gtggaaaagggaggcaagcacaagactggaccaaatctccatggtctgttcgggtggaag
acaggtcaggccgttggattctcctgcacagacgccaacaagaacaaaggcatcacctgg
ggagaggacactctgatggagtatttggagaatcccaaaaaatacatccctggaaccaaa
atgatcttcgctggcattaagaagaagaatgaaaggtcagacttgatagcttatctcaaa
aaagctacgaatgagtaa

KEGG   Oryctolagus cuniculus (rabbit): 100341175
Entry
100341175         CDS       T03373                                 

Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01524  Platinum drug resistance
ocu04115  p53 signaling pathway
ocu04210  Apoptosis
ocu04215  Apoptosis - multiple species
ocu04932  Non-alcoholic fatty liver disease
ocu05010  Alzheimer disease
ocu05012  Parkinson disease
ocu05014  Amyotrophic lateral sclerosis
ocu05016  Huntington disease
ocu05017  Spinocerebellar ataxia
ocu05020  Prion disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05132  Salmonella infection
ocu05134  Legionellosis
ocu05145  Toxoplasmosis
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
ocu05210  Colorectal cancer
ocu05222  Small cell lung cancer
ocu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100341175
   04215 Apoptosis - multiple species
    100341175
   04115 p53 signaling pathway
    100341175
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100341175
  09162 Cancer: specific types
   05210 Colorectal cancer
    100341175
   05222 Small cell lung cancer
    100341175
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100341175
   05012 Parkinson disease
    100341175
   05014 Amyotrophic lateral sclerosis
    100341175
   05016 Huntington disease
    100341175
   05017 Spinocerebellar ataxia
    100341175
   05020 Prion disease
    100341175
   05022 Pathways of neurodegeneration - multiple diseases
    100341175
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100341175
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100341175
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100341175
   05134 Legionellosis
    100341175
   05152 Tuberculosis
    100341175
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100341175
   05162 Measles
    100341175
   05164 Influenza A
    100341175
   05161 Hepatitis B
    100341175
   05160 Hepatitis C
    100341175
   05168 Herpes simplex virus 1 infection
    100341175
   05163 Human cytomegalovirus infection
    100341175
   05167 Kaposi sarcoma-associated herpesvirus infection
    100341175
   05169 Epstein-Barr virus infection
    100341175
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100341175
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100341175
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 UPF0128
Other DBs
NCBI-GeneID: 100341175
NCBI-ProteinID: XP_002713768
Ensembl: ENSOCUG00000025605
UniProt: G1U0B4
LinkDB
Position
10
AA seq 105 aa
MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAVGFSYTDANKNKGITW
GEDTLMEYLENPKKYIPGTKMIFAGIKKKNERADLIAYLKKATNE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggtgatgttgagaaaggcaagaagatttttgttcagaaatgtgcccagtgccacact
gtggaaaagggaggcaagcacaagactggaccaaatctccatggtctgttcgggcggaag
acaggtcaggccgttggattctcctacacagacgccaacaagaacaaaggcatcacctgg
ggagaggacacgctgatggagtatttggagaatcccaagaaatacatccctggaaccaaa
atgatcttcgctggcattaagaagaagaatgaaagggcagacttgatagcttatctcaaa
aaagctacgaatgagtaa

KEGG   Oryctolagus cuniculus (rabbit): 100341515
Entry
100341515         CDS       T03373                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01524  Platinum drug resistance
ocu04115  p53 signaling pathway
ocu04210  Apoptosis
ocu04215  Apoptosis - multiple species
ocu04932  Non-alcoholic fatty liver disease
ocu05010  Alzheimer disease
ocu05012  Parkinson disease
ocu05014  Amyotrophic lateral sclerosis
ocu05016  Huntington disease
ocu05017  Spinocerebellar ataxia
ocu05020  Prion disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05132  Salmonella infection
ocu05134  Legionellosis
ocu05145  Toxoplasmosis
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
ocu05210  Colorectal cancer
ocu05222  Small cell lung cancer
ocu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100341515
   04215 Apoptosis - multiple species
    100341515
   04115 p53 signaling pathway
    100341515
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100341515
  09162 Cancer: specific types
   05210 Colorectal cancer
    100341515
   05222 Small cell lung cancer
    100341515
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100341515
   05012 Parkinson disease
    100341515
   05014 Amyotrophic lateral sclerosis
    100341515
   05016 Huntington disease
    100341515
   05017 Spinocerebellar ataxia
    100341515
   05020 Prion disease
    100341515
   05022 Pathways of neurodegeneration - multiple diseases
    100341515
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100341515
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100341515
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100341515
   05134 Legionellosis
    100341515
   05152 Tuberculosis
    100341515
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100341515
   05162 Measles
    100341515
   05164 Influenza A
    100341515
   05161 Hepatitis B
    100341515
   05160 Hepatitis C
    100341515
   05168 Herpes simplex virus 1 infection
    100341515
   05163 Human cytomegalovirus infection
    100341515
   05167 Kaposi sarcoma-associated herpesvirus infection
    100341515
   05169 Epstein-Barr virus infection
    100341515
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100341515
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100341515
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 UPF0128
Other DBs
NCBI-GeneID: 100341515
NCBI-ProteinID: XP_008255089
Ensembl: ENSOCUG00000027442
UniProt: G1TKY2
LinkDB
Position
4
AA seq 105 aa
MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAVGFSHTDANKNKGITW
GEDTLMEYLENPKKYIPGTKMIFAGIKKKNERADLIAYLKKAMNE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggtgatgttgagaaaggcaagaagatttttgttcagaaatgtgcccagtgccacact
gtggaaaagggaggcaagcacaagactggaccaaatctccatggtctgttcgggcggaag
acaggtcaggccgttggattctcccacacagacgccaacaagaacaaaggcatcacctgg
ggagaggacacgctgatggagtatttggagaatcccaagaaatacatccctggaaccaaa
atgatcttcgctggcattaagaagaagaatgaaagggcagacttgatagcttatctaaaa
aaagctatgaatgagtaa

KEGG   Oryctolagus cuniculus (rabbit): 100351037
Entry
100351037         CDS       T03373                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01524  Platinum drug resistance
ocu04115  p53 signaling pathway
ocu04210  Apoptosis
ocu04215  Apoptosis - multiple species
ocu04932  Non-alcoholic fatty liver disease
ocu05010  Alzheimer disease
ocu05012  Parkinson disease
ocu05014  Amyotrophic lateral sclerosis
ocu05016  Huntington disease
ocu05017  Spinocerebellar ataxia
ocu05020  Prion disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05132  Salmonella infection
ocu05134  Legionellosis
ocu05145  Toxoplasmosis
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
ocu05210  Colorectal cancer
ocu05222  Small cell lung cancer
ocu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100351037
   04215 Apoptosis - multiple species
    100351037
   04115 p53 signaling pathway
    100351037
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100351037
  09162 Cancer: specific types
   05210 Colorectal cancer
    100351037
   05222 Small cell lung cancer
    100351037
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100351037
   05012 Parkinson disease
    100351037
   05014 Amyotrophic lateral sclerosis
    100351037
   05016 Huntington disease
    100351037
   05017 Spinocerebellar ataxia
    100351037
   05020 Prion disease
    100351037
   05022 Pathways of neurodegeneration - multiple diseases
    100351037
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100351037
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100351037
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100351037
   05134 Legionellosis
    100351037
   05152 Tuberculosis
    100351037
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100351037
   05162 Measles
    100351037
   05164 Influenza A
    100351037
   05161 Hepatitis B
    100351037
   05160 Hepatitis C
    100351037
   05168 Herpes simplex virus 1 infection
    100351037
   05163 Human cytomegalovirus infection
    100351037
   05167 Kaposi sarcoma-associated herpesvirus infection
    100351037
   05169 Epstein-Barr virus infection
    100351037
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100351037
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100351037
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 100351037
NCBI-ProteinID: XP_008271136
Ensembl: ENSOCUG00000021641
LinkDB
Position
X
AA seq 105 aa
MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAFGFSYTDAHKNKGITW
GEDTLMEYLENPKKYIPGTKMIFAGIMKKNERADLIAYLKKATNE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggtgatgttgagaaaggcaagaagatttttgttcagaaatgtgcccagtgccacact
gtggaaaagggaggcaagcacaagactggaccaaatctccatggtctgttcgggcggaag
acaggtcaggcctttggattctcctacacagacgcccacaagaacaaaggcatcacctgg
ggagaggacactctgatggagtatttggagaatcccaagaagtacatccctggaaccaaa
atgatcttcgctggcattatgaagaagaatgaaagggcagacttgatagcttatctcaaa
aaagctacgaatgagtaa

KEGG   Oryctolagus cuniculus (rabbit): 100353673
Entry
100353673         CDS       T03373                                 

Definition
(RefSeq) cytochrome c, testis-specific
  KO
K08738  cytochrome c
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01524  Platinum drug resistance
ocu04115  p53 signaling pathway
ocu04210  Apoptosis
ocu04215  Apoptosis - multiple species
ocu04932  Non-alcoholic fatty liver disease
ocu05010  Alzheimer disease
ocu05012  Parkinson disease
ocu05014  Amyotrophic lateral sclerosis
ocu05016  Huntington disease
ocu05017  Spinocerebellar ataxia
ocu05020  Prion disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05132  Salmonella infection
ocu05134  Legionellosis
ocu05145  Toxoplasmosis
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
ocu05210  Colorectal cancer
ocu05222  Small cell lung cancer
ocu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100353673
   04215 Apoptosis - multiple species
    100353673
   04115 p53 signaling pathway
    100353673
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100353673
  09162 Cancer: specific types
   05210 Colorectal cancer
    100353673
   05222 Small cell lung cancer
    100353673
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100353673
   05012 Parkinson disease
    100353673
   05014 Amyotrophic lateral sclerosis
    100353673
   05016 Huntington disease
    100353673
   05017 Spinocerebellar ataxia
    100353673
   05020 Prion disease
    100353673
   05022 Pathways of neurodegeneration - multiple diseases
    100353673
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100353673
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100353673
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100353673
   05134 Legionellosis
    100353673
   05152 Tuberculosis
    100353673
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100353673
   05162 Measles
    100353673
   05164 Influenza A
    100353673
   05161 Hepatitis B
    100353673
   05160 Hepatitis C
    100353673
   05168 Herpes simplex virus 1 infection
    100353673
   05163 Human cytomegalovirus infection
    100353673
   05167 Kaposi sarcoma-associated herpesvirus infection
    100353673
   05169 Epstein-Barr virus infection
    100353673
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100353673
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100353673
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 100353673
NCBI-ProteinID: XP_002712354
Ensembl: ENSOCUG00000025342
UniProt: G1TTC7
LinkDB
Position
7
AA seq 153 aa
MADQTCECHRGPAAEPPPSNSGRGLPPGRGTGEEESRATGPVVPLQSKMGDAETGKKIFI
QKCAQCHTVEKGGKHKTGPNLWGLFGRKTGQAQGFSYSDANKNKGIVWGEDTLMEYLENP
KKYIPGTKMVFAGLKKKTEREDLIQYLKQATSS
NT seq 462 nt   +upstreamnt  +downstreamnt
atggctgaccagacctgcgagtgtcatcgaggccctgctgcagaaccaccaccatcgaac
tcggggcgcggactcccgcctggccgcggcacaggggaggaggagagcagagctactggc
cctgtggttcctctgcagagcaaaatgggagatgctgaaacaggcaagaagatctttatt
cagaaatgtgctcagtgccacacagtagaaaaaggtggaaaacacaagactggtccaaat
ctctggggtctctttggccgaaaaacaggacaagcacaaggattctcttattctgatgca
aacaaaaacaaaggtattgtctggggagaagatactctgatggaatatttggagaaccca
aagaaatatatccctggaactaaaatggtctttgctggtcttaaaaagaagactgagaga
gaagatcttattcaatatttgaaacaggccacgtcttcatga

KEGG   Oryctolagus cuniculus (rabbit): 100354468
Entry
100354468         CDS       T03373                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01524  Platinum drug resistance
ocu04115  p53 signaling pathway
ocu04210  Apoptosis
ocu04215  Apoptosis - multiple species
ocu04932  Non-alcoholic fatty liver disease
ocu05010  Alzheimer disease
ocu05012  Parkinson disease
ocu05014  Amyotrophic lateral sclerosis
ocu05016  Huntington disease
ocu05017  Spinocerebellar ataxia
ocu05020  Prion disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05132  Salmonella infection
ocu05134  Legionellosis
ocu05145  Toxoplasmosis
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
ocu05210  Colorectal cancer
ocu05222  Small cell lung cancer
ocu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100354468
   04215 Apoptosis - multiple species
    100354468
   04115 p53 signaling pathway
    100354468
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100354468
  09162 Cancer: specific types
   05210 Colorectal cancer
    100354468
   05222 Small cell lung cancer
    100354468
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100354468
   05012 Parkinson disease
    100354468
   05014 Amyotrophic lateral sclerosis
    100354468
   05016 Huntington disease
    100354468
   05017 Spinocerebellar ataxia
    100354468
   05020 Prion disease
    100354468
   05022 Pathways of neurodegeneration - multiple diseases
    100354468
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100354468
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100354468
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100354468
   05134 Legionellosis
    100354468
   05152 Tuberculosis
    100354468
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100354468
   05162 Measles
    100354468
   05164 Influenza A
    100354468
   05161 Hepatitis B
    100354468
   05160 Hepatitis C
    100354468
   05168 Herpes simplex virus 1 infection
    100354468
   05163 Human cytomegalovirus infection
    100354468
   05167 Kaposi sarcoma-associated herpesvirus infection
    100354468
   05169 Epstein-Barr virus infection
    100354468
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100354468
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100354468
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 UPF0128 CCP_MauG
Other DBs
NCBI-GeneID: 100354468
NCBI-ProteinID: XP_008269975
Ensembl: ENSOCUG00000027438
UniProt: G1TFS7
LinkDB
Position
19
AA seq 105 aa
MGDVEKGKKAFVQKCAQCHTVEKGGKHKTGPTLHGLFGRKTGQAIGFSYTDANKNKGITW
GEDTLMEYLENPKKYIPGTKMIFAGIKKKNERADLIAYLKKATNE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggtgatgttgagaaaggcaagaaggcttttgttcagaaatgtgcccagtgccacact
gtggaaaagggaggcaagcacaagactggaccaactctccatggtctgttcgggcggaag
acaggtcaggccattgggttctcctacacagatgccaacaagaacaaaggcatcacctgg
ggagaggacactctgatggagtatttggagaatcccaagaaatacatccctggaaccaaa
atgatcttcgctggcattaagaagaagaatgaaagggcagacttgatagcttatctcaaa
aaagctacgaatgagtaa

KEGG   Oryctolagus cuniculus (rabbit): 100354724
Entry
100354724         CDS       T03373                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01524  Platinum drug resistance
ocu04115  p53 signaling pathway
ocu04210  Apoptosis
ocu04215  Apoptosis - multiple species
ocu04932  Non-alcoholic fatty liver disease
ocu05010  Alzheimer disease
ocu05012  Parkinson disease
ocu05014  Amyotrophic lateral sclerosis
ocu05016  Huntington disease
ocu05017  Spinocerebellar ataxia
ocu05020  Prion disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05132  Salmonella infection
ocu05134  Legionellosis
ocu05145  Toxoplasmosis
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
ocu05210  Colorectal cancer
ocu05222  Small cell lung cancer
ocu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100354724
   04215 Apoptosis - multiple species
    100354724
   04115 p53 signaling pathway
    100354724
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100354724
  09162 Cancer: specific types
   05210 Colorectal cancer
    100354724
   05222 Small cell lung cancer
    100354724
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100354724
   05012 Parkinson disease
    100354724
   05014 Amyotrophic lateral sclerosis
    100354724
   05016 Huntington disease
    100354724
   05017 Spinocerebellar ataxia
    100354724
   05020 Prion disease
    100354724
   05022 Pathways of neurodegeneration - multiple diseases
    100354724
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100354724
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100354724
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100354724
   05134 Legionellosis
    100354724
   05152 Tuberculosis
    100354724
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100354724
   05162 Measles
    100354724
   05164 Influenza A
    100354724
   05161 Hepatitis B
    100354724
   05160 Hepatitis C
    100354724
   05168 Herpes simplex virus 1 infection
    100354724
   05163 Human cytomegalovirus infection
    100354724
   05167 Kaposi sarcoma-associated herpesvirus infection
    100354724
   05169 Epstein-Barr virus infection
    100354724
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100354724
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100354724
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 UPF0128
Other DBs
NCBI-GeneID: 100354724
NCBI-ProteinID: XP_002719667
LinkDB
Position
20
AA seq 105 aa
MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAVGFSYTDANKNKGITW
GEDTLMEYLENPKKYIPGTKMIFAGIKKKTERADLIAYLKKATNE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggtgatgttgagaaaggcaagaagatttttgttcagaaatgtgcccagtgccacact
gtggaaaagggaggcaagcacaagactggaccaaatctccatggtctgttcgggcggaag
acaggtcaggccgttggattctcctacacagacgccaacaagaacaaaggcatcacctgg
ggagaggacacgctgatggagtatttggagaatcccaagaaatacatccctggaaccaaa
atgatcttcgctggcattaagaagaagactgaaagggcagacttgatagcttatctcaaa
aaagctacgaatgagtaa

KEGG   Oryctolagus cuniculus (rabbit): 100355084
Entry
100355084         CDS       T03373                                 

Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01524  Platinum drug resistance
ocu04115  p53 signaling pathway
ocu04210  Apoptosis
ocu04215  Apoptosis - multiple species
ocu04932  Non-alcoholic fatty liver disease
ocu05010  Alzheimer disease
ocu05012  Parkinson disease
ocu05014  Amyotrophic lateral sclerosis
ocu05016  Huntington disease
ocu05017  Spinocerebellar ataxia
ocu05020  Prion disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05132  Salmonella infection
ocu05134  Legionellosis
ocu05145  Toxoplasmosis
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
ocu05210  Colorectal cancer
ocu05222  Small cell lung cancer
ocu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100355084
   04215 Apoptosis - multiple species
    100355084
   04115 p53 signaling pathway
    100355084
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100355084
  09162 Cancer: specific types
   05210 Colorectal cancer
    100355084
   05222 Small cell lung cancer
    100355084
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100355084
   05012 Parkinson disease
    100355084
   05014 Amyotrophic lateral sclerosis
    100355084
   05016 Huntington disease
    100355084
   05017 Spinocerebellar ataxia
    100355084
   05020 Prion disease
    100355084
   05022 Pathways of neurodegeneration - multiple diseases
    100355084
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100355084
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100355084
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100355084
   05134 Legionellosis
    100355084
   05152 Tuberculosis
    100355084
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100355084
   05162 Measles
    100355084
   05164 Influenza A
    100355084
   05161 Hepatitis B
    100355084
   05160 Hepatitis C
    100355084
   05168 Herpes simplex virus 1 infection
    100355084
   05163 Human cytomegalovirus infection
    100355084
   05167 Kaposi sarcoma-associated herpesvirus infection
    100355084
   05169 Epstein-Barr virus infection
    100355084
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100355084
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100355084
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 UPF0128
Other DBs
NCBI-GeneID: 100355084
NCBI-ProteinID: XP_017205665
Ensembl: ENSOCUG00000028125
UniProt: G1U0B4
LinkDB
Position
Un
AA seq 105 aa
MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAVGFSYTDANKNKGITW
GEDTLMEYLENPKKYIPGTKMIFAGIKKKNERADLIAYLKKATNE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggtgatgttgagaagggcaagaagatttttgttcagaaatgtgcccagtgccacact
gtggaaaagggaggcaagcacaagactggaccaaatctccatggtctgttcgggcggaag
acaggtcaggccgttggattctcctacacagacgccaacaagaacaaaggcatcacctgg
ggagaggacacgctgatggagtatttggagaatcccaagaaatacatccctggaaccaaa
atgatcttcgctggcattaagaagaagaatgaaagggcagacttgatagcttatctcaaa
aaagctacgaatgagtaa

KEGG   Oryctolagus cuniculus (rabbit): 100357329
Entry
100357329         CDS       T03373                                 

Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01524  Platinum drug resistance
ocu04115  p53 signaling pathway
ocu04210  Apoptosis
ocu04215  Apoptosis - multiple species
ocu04932  Non-alcoholic fatty liver disease
ocu05010  Alzheimer disease
ocu05012  Parkinson disease
ocu05014  Amyotrophic lateral sclerosis
ocu05016  Huntington disease
ocu05017  Spinocerebellar ataxia
ocu05020  Prion disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05132  Salmonella infection
ocu05134  Legionellosis
ocu05145  Toxoplasmosis
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
ocu05210  Colorectal cancer
ocu05222  Small cell lung cancer
ocu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100357329
   04215 Apoptosis - multiple species
    100357329
   04115 p53 signaling pathway
    100357329
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100357329
  09162 Cancer: specific types
   05210 Colorectal cancer
    100357329
   05222 Small cell lung cancer
    100357329
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100357329
   05012 Parkinson disease
    100357329
   05014 Amyotrophic lateral sclerosis
    100357329
   05016 Huntington disease
    100357329
   05017 Spinocerebellar ataxia
    100357329
   05020 Prion disease
    100357329
   05022 Pathways of neurodegeneration - multiple diseases
    100357329
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100357329
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100357329
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100357329
   05134 Legionellosis
    100357329
   05152 Tuberculosis
    100357329
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100357329
   05162 Measles
    100357329
   05164 Influenza A
    100357329
   05161 Hepatitis B
    100357329
   05160 Hepatitis C
    100357329
   05168 Herpes simplex virus 1 infection
    100357329
   05163 Human cytomegalovirus infection
    100357329
   05167 Kaposi sarcoma-associated herpesvirus infection
    100357329
   05169 Epstein-Barr virus infection
    100357329
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100357329
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100357329
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 UPF0128
Other DBs
NCBI-GeneID: 100357329
NCBI-ProteinID: XP_008261669
Ensembl: ENSOCUG00000027375
UniProt: G1U0B4
LinkDB
Position
12
AA seq 105 aa
MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAVGFSYTDANKNKGITW
GEDTLMEYLENPKKYIPGTKMIFAGIKKKNERADLIAYLKKATNE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggtgatgttgagaaaggcaagaagatttttgttcagaaatgtgcccagtgccacact
gtggaaaagggaggcaagcacaagactggaccaaatctccatggtctgtttgggcggaag
acaggtcaggccgttggattctcctacacagacgccaacaagaacaaaggcatcacctgg
ggagaggacacgctgatggagtatttggagaatcccaagaaatacatccctggaaccaaa
atgatcttcgctggcattaagaagaagaatgaaagggcagacttgatagcttatctcaaa
aaagctacgaatgagtaa

KEGG   Oryctolagus cuniculus (rabbit): 100357840
Entry
100357840         CDS       T03373                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01524  Platinum drug resistance
ocu04115  p53 signaling pathway
ocu04210  Apoptosis
ocu04215  Apoptosis - multiple species
ocu04932  Non-alcoholic fatty liver disease
ocu05010  Alzheimer disease
ocu05012  Parkinson disease
ocu05014  Amyotrophic lateral sclerosis
ocu05016  Huntington disease
ocu05017  Spinocerebellar ataxia
ocu05020  Prion disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05132  Salmonella infection
ocu05134  Legionellosis
ocu05145  Toxoplasmosis
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
ocu05210  Colorectal cancer
ocu05222  Small cell lung cancer
ocu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100357840
   04215 Apoptosis - multiple species
    100357840
   04115 p53 signaling pathway
    100357840
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100357840
  09162 Cancer: specific types
   05210 Colorectal cancer
    100357840
   05222 Small cell lung cancer
    100357840
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100357840
   05012 Parkinson disease
    100357840
   05014 Amyotrophic lateral sclerosis
    100357840
   05016 Huntington disease
    100357840
   05017 Spinocerebellar ataxia
    100357840
   05020 Prion disease
    100357840
   05022 Pathways of neurodegeneration - multiple diseases
    100357840
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100357840
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100357840
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100357840
   05134 Legionellosis
    100357840
   05152 Tuberculosis
    100357840
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100357840
   05162 Measles
    100357840
   05164 Influenza A
    100357840
   05161 Hepatitis B
    100357840
   05160 Hepatitis C
    100357840
   05168 Herpes simplex virus 1 infection
    100357840
   05163 Human cytomegalovirus infection
    100357840
   05167 Kaposi sarcoma-associated herpesvirus infection
    100357840
   05169 Epstein-Barr virus infection
    100357840
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100357840
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100357840
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 UPF0128
Other DBs
NCBI-GeneID: 100357840
NCBI-ProteinID: XP_008260510
Ensembl: ENSOCUG00000027381
UniProt: G1TY21
LinkDB
Position
11
AA seq 105 aa
MGDVEKGKKIFVQKCAQCHTVEKGGKHKTEPNLHGLFGRKTGQAVGFSYTDANKNKGITW
GEDTLMEYLENPKKYIPGTKRIFAGIKKKNERADLIAYLKKATNE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggtgatgttgaaaaaggcaagaagatttttgttcagaaatgtgcccagtgccacact
gtggaaaagggaggcaagcacaagactgaaccaaatctccatggtctgttcgggcggaag
acaggtcaggccgttggattctcctacacagacgccaacaagaacaaaggcatcacctgg
ggagaggacacgctgatggagtatttggagaatcccaagaaatacatccctggaaccaaa
aggatcttcgctggcattaagaagaagaatgaaagggcagacttgatagcttatctcaaa
aaagctacgaatgagtaa

KEGG   Oryctolagus cuniculus (rabbit): 103347723
Entry
103347723         CDS       T03373                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01524  Platinum drug resistance
ocu04115  p53 signaling pathway
ocu04210  Apoptosis
ocu04215  Apoptosis - multiple species
ocu04932  Non-alcoholic fatty liver disease
ocu05010  Alzheimer disease
ocu05012  Parkinson disease
ocu05014  Amyotrophic lateral sclerosis
ocu05016  Huntington disease
ocu05017  Spinocerebellar ataxia
ocu05020  Prion disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05132  Salmonella infection
ocu05134  Legionellosis
ocu05145  Toxoplasmosis
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
ocu05210  Colorectal cancer
ocu05222  Small cell lung cancer
ocu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103347723
   04215 Apoptosis - multiple species
    103347723
   04115 p53 signaling pathway
    103347723
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103347723
  09162 Cancer: specific types
   05210 Colorectal cancer
    103347723
   05222 Small cell lung cancer
    103347723
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103347723
   05012 Parkinson disease
    103347723
   05014 Amyotrophic lateral sclerosis
    103347723
   05016 Huntington disease
    103347723
   05017 Spinocerebellar ataxia
    103347723
   05020 Prion disease
    103347723
   05022 Pathways of neurodegeneration - multiple diseases
    103347723
  09166 Cardiovascular disease
   05416 Viral myocarditis
    103347723
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103347723
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103347723
   05134 Legionellosis
    103347723
   05152 Tuberculosis
    103347723
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103347723
   05162 Measles
    103347723
   05164 Influenza A
    103347723
   05161 Hepatitis B
    103347723
   05160 Hepatitis C
    103347723
   05168 Herpes simplex virus 1 infection
    103347723
   05163 Human cytomegalovirus infection
    103347723
   05167 Kaposi sarcoma-associated herpesvirus infection
    103347723
   05169 Epstein-Barr virus infection
    103347723
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103347723
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    103347723
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 DUF3365
Other DBs
NCBI-GeneID: 103347723
NCBI-ProteinID: XP_008252897
LinkDB
Position
2
AA seq 102 aa
MSDAEKGEISAQKCVQCHTVRKGGKPRSGQNLHGLFGWKTGQAVGFSYTDGNRNKAITWE
GDILIEYLENLKKYIPGTKFIFIGIKKRNERADLMAYLKEDY
NT seq 309 nt   +upstreamnt  +downstreamnt
atgagtgatgctgagaaaggcgagatttctgctcagaaatgtgtccagtgccacactgtg
agaaaggggggcaagcccaggtctgggcagaatctccatggcctgtttgggtggaagaca
ggtcaggctgttggattctcttacacagatggcaacaggaacaaagccatcacctgggag
ggggacattctgatagagtatttggagaatctcaagaaatacatccctggaaccaaattt
attttcattggaattaagaaaaggaatgaaagggcagacttgatggcttatctcaaagag
gactactaa

KEGG   Oryctolagus cuniculus (rabbit): 103351673
Entry
103351673         CDS       T03373                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01524  Platinum drug resistance
ocu04115  p53 signaling pathway
ocu04210  Apoptosis
ocu04215  Apoptosis - multiple species
ocu04932  Non-alcoholic fatty liver disease
ocu05010  Alzheimer disease
ocu05012  Parkinson disease
ocu05014  Amyotrophic lateral sclerosis
ocu05016  Huntington disease
ocu05017  Spinocerebellar ataxia
ocu05020  Prion disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05132  Salmonella infection
ocu05134  Legionellosis
ocu05145  Toxoplasmosis
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
ocu05210  Colorectal cancer
ocu05222  Small cell lung cancer
ocu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    103351673
   04215 Apoptosis - multiple species
    103351673
   04115 p53 signaling pathway
    103351673
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103351673
  09162 Cancer: specific types
   05210 Colorectal cancer
    103351673
   05222 Small cell lung cancer
    103351673
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103351673
   05012 Parkinson disease
    103351673
   05014 Amyotrophic lateral sclerosis
    103351673
   05016 Huntington disease
    103351673
   05017 Spinocerebellar ataxia
    103351673
   05020 Prion disease
    103351673
   05022 Pathways of neurodegeneration - multiple diseases
    103351673
  09166 Cardiovascular disease
   05416 Viral myocarditis
    103351673
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103351673
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103351673
   05134 Legionellosis
    103351673
   05152 Tuberculosis
    103351673
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103351673
   05162 Measles
    103351673
   05164 Influenza A
    103351673
   05161 Hepatitis B
    103351673
   05160 Hepatitis C
    103351673
   05168 Herpes simplex virus 1 infection
    103351673
   05163 Human cytomegalovirus infection
    103351673
   05167 Kaposi sarcoma-associated herpesvirus infection
    103351673
   05169 Epstein-Barr virus infection
    103351673
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103351673
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    103351673
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 Cytochrome-c551
Other DBs
NCBI-GeneID: 103351673
NCBI-ProteinID: XP_017204946
LinkDB
Position
20
AA seq 90 aa
MRELKMGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFRRKTGQAVFYTDANKNKG
ITWGEDTLMEYLENPKKYIPGTKMIFAGQT
NT seq 273 nt   +upstreamnt  +downstreamnt
atgagagagttaaaaatgggtgatgttgagaaaggcaagaagatttttgttcagaaatgt
gcccagtgccacactgtggaaaaaggaggcaagcacaagactggaccaaatctccatggt
ctgttcaggcggaagacaggtcaggccgtcttctacacagacgccaacaagaacaaaggc
atcacctggggagaggacactctgatggagtatttggagaatcccaagaaatacatccct
ggaaccaaaatgatcttcgctgggcagacttga

KEGG   Oryctolagus cuniculus (rabbit): 108177422
Entry
108177422         CDS       T03373                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01524  Platinum drug resistance
ocu04115  p53 signaling pathway
ocu04210  Apoptosis
ocu04215  Apoptosis - multiple species
ocu04932  Non-alcoholic fatty liver disease
ocu05010  Alzheimer disease
ocu05012  Parkinson disease
ocu05014  Amyotrophic lateral sclerosis
ocu05016  Huntington disease
ocu05017  Spinocerebellar ataxia
ocu05020  Prion disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05132  Salmonella infection
ocu05134  Legionellosis
ocu05145  Toxoplasmosis
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
ocu05210  Colorectal cancer
ocu05222  Small cell lung cancer
ocu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108177422
   04215 Apoptosis - multiple species
    108177422
   04115 p53 signaling pathway
    108177422
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108177422
  09162 Cancer: specific types
   05210 Colorectal cancer
    108177422
   05222 Small cell lung cancer
    108177422
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108177422
   05012 Parkinson disease
    108177422
   05014 Amyotrophic lateral sclerosis
    108177422
   05016 Huntington disease
    108177422
   05017 Spinocerebellar ataxia
    108177422
   05020 Prion disease
    108177422
   05022 Pathways of neurodegeneration - multiple diseases
    108177422
  09166 Cardiovascular disease
   05416 Viral myocarditis
    108177422
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    108177422
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108177422
   05134 Legionellosis
    108177422
   05152 Tuberculosis
    108177422
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108177422
   05162 Measles
    108177422
   05164 Influenza A
    108177422
   05161 Hepatitis B
    108177422
   05160 Hepatitis C
    108177422
   05168 Herpes simplex virus 1 infection
    108177422
   05163 Human cytomegalovirus infection
    108177422
   05167 Kaposi sarcoma-associated herpesvirus infection
    108177422
   05169 Epstein-Barr virus infection
    108177422
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108177422
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108177422
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 UPF0128 CCP_MauG
Other DBs
NCBI-GeneID: 108177422
NCBI-ProteinID: XP_017200582
LinkDB
Position
12
AA seq 105 aa
MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPTLHGLFGRKTGQAVGFSYTDASKNKGITW
GEDTLMEYLEKPKKYIPGTKMIFAGIKKKNERADLIAYLKKATNE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggtgatgttgagaaaggcaagaagatttttgttcagaaatgtgcccagtgccacact
gtggaaaagggaggcaagcacaagactggaccaactctccatggtctgttcgggcggaag
acaggtcaggccgttggattctcctacacagatgccagcaagaacaaaggcatcacctgg
ggagaggacacgctgatggaatatttggagaagcccaagaaatacatccctggaaccaaa
atgatcttcgctggcattaagaagaagaatgaaagggcagacttgatagcttatctcaaa
aaagctacgaatgagtaa

KEGG   Oryctolagus cuniculus (rabbit): 108178730
Entry
108178730         CDS       T03373                                 

Definition
(RefSeq) cytochrome c-like
  KO
K08738  cytochrome c
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu01524  Platinum drug resistance
ocu04115  p53 signaling pathway
ocu04210  Apoptosis
ocu04215  Apoptosis - multiple species
ocu04932  Non-alcoholic fatty liver disease
ocu05010  Alzheimer disease
ocu05012  Parkinson disease
ocu05014  Amyotrophic lateral sclerosis
ocu05016  Huntington disease
ocu05017  Spinocerebellar ataxia
ocu05020  Prion disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05132  Salmonella infection
ocu05134  Legionellosis
ocu05145  Toxoplasmosis
ocu05152  Tuberculosis
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
ocu05210  Colorectal cancer
ocu05222  Small cell lung cancer
ocu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108178730
   04215 Apoptosis - multiple species
    108178730
   04115 p53 signaling pathway
    108178730
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108178730
  09162 Cancer: specific types
   05210 Colorectal cancer
    108178730
   05222 Small cell lung cancer
    108178730
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    108178730
   05012 Parkinson disease
    108178730
   05014 Amyotrophic lateral sclerosis
    108178730
   05016 Huntington disease
    108178730
   05017 Spinocerebellar ataxia
    108178730
   05020 Prion disease
    108178730
   05022 Pathways of neurodegeneration - multiple diseases
    108178730
  09166 Cardiovascular disease
   05416 Viral myocarditis
    108178730
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    108178730
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    108178730
   05134 Legionellosis
    108178730
   05152 Tuberculosis
    108178730
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    108178730
   05162 Measles
    108178730
   05164 Influenza A
    108178730
   05161 Hepatitis B
    108178730
   05160 Hepatitis C
    108178730
   05168 Herpes simplex virus 1 infection
    108178730
   05163 Human cytomegalovirus infection
    108178730
   05167 Kaposi sarcoma-associated herpesvirus infection
    108178730
   05169 Epstein-Barr virus infection
    108178730
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    108178730
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    108178730
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 108178730
NCBI-ProteinID: XP_017205261
UniProt: G1TVV5
LinkDB
Position
X
AA seq 105 aa
MGDVEKGKKIFVRKCAQCHTVEKGGKQKTGPNLHGLFGRKTGQAIGFSYTDTYKNKGNTW
GEDILMEYLEKPKKYIPGTKMTLAGIKKKNERADLIAYLKKATNE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggtgatgttgagaaaggcaagaagatttttgttcggaaatgtgcccagtgccacact
gtggaaaagggaggcaagcaaaagactggaccaaatctccatggtctgtttgggcggaag
acaggtcaggccattggattctcctacacagacacctacaagaacaaaggcaacacctgg
ggagaggacattctgatggagtatttggagaagcccaagaaatacatccctggaaccaaa
atgaccttagctggcattaagaagaagaatgaaagggcagacttgatagcttatctcaaa
aaagctacgaatgagtaa

DBGET integrated database retrieval system