KEGG   Oryctolagus cuniculus (rabbit): 100341056
Entry
100341056         CDS       T03373                                 

Gene name
FIP1L1
Definition
(RefSeq) factor interacting with PAPOLA and CPSF1
  KO
K14405  pre-mRNA 3'-end-processing factor FIP1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100341056 (FIP1L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100341056 (FIP1L1)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     100341056 (FIP1L1)
SSDB
Motif
Pfam: Fip1
Other DBs
NCBI-GeneID: 100341056
NCBI-ProteinID: XP_002721830
Ensembl: ENSOCUG00000000100
UniProt: G1SCL2
LinkDB
Position
Un
AA seq 603 aa
MSAGEVDRLVSELSGGTGGDEEEEWLYGGPWDVHVHSDLAKDLDENEVERPEEENTSANP
PSGVEDEAAENGVPKPKVTETEDDSDSDSDDDEDDVHVTIGDIKTGAPQYGSYGTAPVNL
NIKTGGRVYGTTGTKVKGVDLDAPGSINGVPLLEVDLDSFEDKPWRKPGADLSDYFNYGF
NEDTWKAYCEKQKRIRMGLEVIPVTSTTNKITAEDCTMEVTPGAEIQDDRFNLFKVQQGR
TGNSEKEAALPSTKAEFTSPPSLFKTGLPPSRNSASSQSQPSAASRKASSSVGKWQDRYG
RAESPDLRRLPGAIDVIGQTITISRVEGRRRANENSNIQVLSERSAAEVDNNFSKPPPFF
PPGGPPTHLPPPPFLPPPPTVSTAPPLIPPPGIPITVPPPGFPPPPGAPPPSLIPTIESG
HSSGYDSRSARAFPYGNVAFPHLPGSAPSWPSLVDTSKQWDYYARREKDRDRERDRDRER
DRDRDRERERTRERERERDHSPTPSVFNSDEERYRYREYAERGYERHRASREKEERHRER
RHREKEESRHKSSRSNSRRRHESEEGDSHRRHKHKKSKRSKEGKEAGSEPAPEQESTEAA
PAE
NT seq 1812 nt   +upstreamnt  +downstreamnt
atgtcggccggcgaggtggaccgccttgtgtcggaactgagcggcgggaccggaggggat
gaggaggaggagtggctgtatggcggcccgtgggacgtgcacgtgcacagtgacttggca
aaggacctagatgaaaatgaagttgaaaggccagaagaagagaataccagtgctaatcct
ccatctggggttgaagatgaagctgctgaaaatggcgtaccaaaaccgaaagtgaccgag
acagaagacgatagtgatagtgacagtgatgatgatgaggacgatgttcacgtcaccata
ggagacataaaaacgggagctccacagtatgggagttatggtacagcacctgtaaatctt
aatatcaagacaggaggcagagtttatggaactacaggaacaaaagtcaaaggggtagac
cttgatgcccctgggagcattaatggagtcccactcctggaggtcgatctggactctttt
gaagataagccatggcggaaacctggtgctgatctttctgattattttaattatggattt
aatgaagatacttggaaagcttactgtgaaaagcaaaagaggatacgaatgggacttgaa
gttataccagttacctctactacaaataagattacggccgaagactgtactatggaagtt
acaccaggtgcagagatccaagatgacagattcaatctttttaaggtgcagcagggaaga
actggaaattcagagaaggaagcggcacttccatctaccaaagcagagttcacttctcct
ccctctttgttcaagactgggctcccaccaagcaggaacagcgcctcgtctcagtctcag
ccgagtgctgcctccagaaaagccagctcaagcgtcggcaagtggcaggatcgctacggg
agggccgaatcgcctgatctaaggagattacctggggcaatcgatgttattggccagact
atcaccattagccgggtagaaggccggcgccgggcgaatgaaaacagcaacatacaggtc
ctttctgaaagatcggctgctgaagtggacaacaattttagcaaaccacctccgtttttc
cctccagggggtcctcctacccaccttccaccacctccatttcttccacctcctcccact
gtcagcactgctccacctctgattccacccccaggtattccaataactgtaccacctcca
ggttttcctccaccaccaggcgctcctccgccgtctcttatcccaacgatagaaagtggg
cattcctctggttatgatagtcgttctgcacgggcattcccatatggcaatgttgctttt
ccccatcttcctggttctgctccttcatggcctagtcttgtggacaccagcaagcagtgg
gactattacgcgagaagagagaaagaccgagacagagaaagagacagagacagagagcgc
gaccgggaccgggaccgagaaagagagcgcacccgcgagagagagcgagagcgtgaccac
agtcccacgccgagtgtcttcaacagtgacgaagagcgatacagatacagagaatatgcc
gagagagggtatgagcggcacagagcgagtcgggagaaagaggagcggcacagagagaga
cggcacagggagaaggaggagagcagacacaagtcctctcgaagtaacagtagacgtcgc
catgagagtgaagaaggagacagtcacaggaggcacaaacacaaaaaatctaaaagaagc
aaagaagggaaggaggccggcagtgagcccgcccccgagcaggagagcaccgaggcggca
cccgcagagtag

DBGET integrated database retrieval system