KEGG   Oryctolagus cuniculus (rabbit): 100341361
Entry
100341361         CDS       T03373                                 

Gene name
SMG5
Definition
(RefSeq) SMG5, nonsense mediated mRNA decay factor
  KO
K11125  protein SMG5
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100341361 (SMG5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100341361 (SMG5)
   03032 DNA replication proteins [BR:ocu03032]
    100341361 (SMG5)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Other surveillance  factors
     100341361 (SMG5)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100341361 (SMG5)
DNA replication proteins [BR:ocu03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Telomerase complex (animals)
    100341361 (SMG5)
SSDB
Motif
Pfam: EST1_DNA_bind EST1 PIN_4
Other DBs
NCBI-GeneID: 100341361
NCBI-ProteinID: XP_008262537
Ensembl: ENSOCUG00000012886
LinkDB
Position
13
AA seq 1016 aa
MSQGPPTGESSEPEAKVLHTKRLYRAVVEAVHRLDLILCNKTAYQEVFKPENISLRNKLR
ELCVKLMFLHPVDYGRKAEELLWRKVYYEVIQLIKTNKKHIHSRSTLECAYRTHLVAGIG
FYQHLLLYIQSHYQLELQCCIDWTHVTDPLIGCKKPVSASGKEMDWAQMACHRCLVYLGD
LSRYQNELAGVDTELLAERFYYQALSVAPQIGMPFNQLGTLAGSKYYNVEAMYCYLRCIQ
SEVSFEGAYGNLKRLYDKAAKMYHQLKKCETRKLSPSRKRGKDIKRLLVNFMYLQSLLQP
KSSSVDSELTSLCQSVLEDFNLCLFYLPSSPNLSLASEDEEEYESGYAFLPDLLIFQMVI
ICLMGVHSLKRAGSKQYSAAIAFTLALFSHLVNHVNIRLQAELEEGENPVPAFQSDGTDE
PESKEPLEKEEEPEPEPPSPAPQAEEGRKSRKFSRLSCLRRRRHPPKAGDDSDLSEGFES
DSSHDSARASEGSDSGSDKSLEGGGTAFDAETDSEMNSQESRSDLEDMEDEEGTRSPAPE
PPRARSEAPESLNGPLGPSEASIASNLQAMSTQMFQTKRCFRLAPTFSNLLLQPSTEAHA
LASRGPCVNGDVEKPAEPASEEGSESEGSESSGRSCRNERSVQEKLQVLMAEGLLPAVKV
FLDWLRTNPDLIIVCAQSSQSLWNRLSVLLNLLPAAGELQESGLGLCPEVQDLLEACELP
ELPSSLLLPEDMALRNLPPLRAAHTRFSFDTDRPLLSVLEESVVRICCIRSFGHFVARLQ
GSILQFNPEVGIFISIAQSEQESLLQQAQAQFRMAQEEARRNRLMRDMAQLRLQLEVSQL
EGSLQQPRAQSAMSPYLIPDTQALCHHLPLIRQLAASGRFIVLIPRTVIDGLDLLKKEHP
GARDGIRYLEAEFKKGNRYIRCQKEVGKSFERHKLKRQDADAWTLYKILDSCKQLTLTQG
AGEEDPSGMVTIVTGLPLDNPSALSGPMQAALQAAAHASVDIKNVLDFYKQWKEIG
NT seq 3051 nt   +upstreamnt  +downstreamnt
atgagccaaggcccccccacgggggagagcagcgagcccgaagcaaaggtcctccacact
aagcggctttaccgggctgtggtggaggctgtgcatcgacttgatctcatcctttgcaac
aaaaccgcttatcaagaagtgttcaagccggagaacattagcctgaggaacaagctgcgt
gagctctgcgtcaagcttatgttcctgcacccagtggactatgggaggaaggctgaggag
cttctgtggagaaaggtgtactatgaagttatccagcttatcaagactaacaaaaagcac
atccacagccggagcactttggaatgtgcctacaggactcacctggtcgctggcattggc
ttctaccagcatctcctcctctacatccagtcccactaccagctcgaactgcagtgctgc
atcgactggacccacgtcaccgaccccctcataggatgcaagaagccagtgtctgcctca
gggaaggagatggactgggcgcagatggcgtgccaccgatgtctggtgtacctgggagat
ctgtcgcgatatcagaatgaattggctggtgtagacactgagctgctagctgagaggttt
tactaccaagctctgtcagtggctccccagattggaatgcccttcaaccagctgggcacg
cttgcaggcagcaagtactataacgtagaagccatgtattgctacctgcgctgcatccag
tcggaagtgtcctttgaaggagcctatgggaacctcaagcggctgtatgacaaggcagcc
aaaatgtaccaccagctgaagaagtgtgagacccggaaactgtcccccagcaggaagcgc
ggtaaggacatcaagaggctgctggtgaacttcatgtacctgcagagcctcctgcagccc
aagagcagctccgtggactcagagctgacctcgctttgccagtcggtcctggaagacttc
aacctctgtctcttctacctgccctcctcgcccaacctcagcctggccagtgaggacgag
gaggagtacgagagtggatatgccttcctcccggaccttctcatctttcagatggtcatc
atctgccttatgggggtgcacagcttgaagcgagcaggatccaagcagtacagcgcagcc
attgccttcaccttggccctgttttcccacctcgtcaatcatgtcaacatacggctgcag
gcggagctggaggagggcgagaaccctgtcccggccttccagagtgatggcacagatgaa
ccagaatctaaggaacccctggaaaaagaagaggagccagaacctgagcctccttcccct
gccccacaagcggaggagggccgaaagagccggaagttctcccgcctctcctgcctccgc
cgccgccgccacccacccaaagccggtgatgacagtgacctgagtgagggcttcgaatcg
gattcaagccatgactcggcccgggccagcgagggctcagacagtggctctgacaagagt
cttgaaggtgggggcacagcctttgatgctgagacagactcagagatgaacagccaggag
tcccgatccgacctggaagacatggaggatgaggaggggacacggtccccggccccggag
ccccctcgggccagatcagaggctcccgagtccctcaacggcccactcggccccagcgag
gcaagcattgccagcaacctacaagccatgtccacccagatgttccagaccaagcgctgc
ttccgcctggcgcccaccttcagcaacctgctcctgcagcccagcaccgaagcgcatgcc
ttggccagccgagggccgtgtgtcaacggggatgtggagaagcctgcagagccagcctcc
gaagaaggctccgagtcagaggggagcgagtccagtgggcgttcctgtcggaacgagcgc
agcgtccaagagaagctgcaggtgctgatggccgaaggcctgcttcccgccgtgaaggtc
ttcctggactggctgcgcaccaaccccgacctcatcatcgtgtgtgcgcagagttcccag
agcctctggaaccgcctgtccgtgttgctgaatctactgccagccgctggcgaacttcag
gagtctgggctgggcctgtgtcctgaggtccaggatctgctcgaggcttgtgaactgcct
gagctcccctccagcctgctgctgccagaggacatggccctccgaaacctgcctccgctg
cgggctgcgcacacgcgcttcagcttcgacacggaccggcccctgctcagcgtcctagag
gagtcggtggtgcgcatctgctgcatccgcagctttgggcacttcgtcgcccgcctgcaa
ggcagcatcctgcagttcaaccccgaggtgggcatcttcatcagcatcgcccagtctgag
caggagagcctgctgcagcaggcccaggcccagttccgcatggcgcaggaggaggcgcga
cggaacaggctgatgagggacatggctcagctgcggctccagctcgaagtgtctcagctg
gagggcagcttgcagcagcccagggcccagtcggccatgtctccctacctcatccccgac
acccaggccctctgccaccacctcccgctcatccgccagctggccgccagcggccgtttc
atcgtcctgataccgaggacagtgatcgatggcctggatttgctgaagaaggagcacccc
ggggcccgggacgggatacgttacctggaggcagagtttaaaaaaggaaacaggtacatt
cgctgccagaaggaggtgggaaagagctttgagcgccataagctgaagaggcaggatgca
gatgcctggaccctctataagatcctggacagctgcaaacagctgactctgacccagggg
gcaggggaagaggacccgagtggcatggtgaccatcgtcacgggccttccactggacaac
cccagtgcgctgtcaggccccatgcaggcagccctgcaggccgctgcccacgccagcgtg
gacatcaagaacgttctagacttctacaagcagtggaaggagattggttga

DBGET integrated database retrieval system