KEGG   Oryctolagus cuniculus (rabbit): 100341564
Entry
100341564         CDS       T03373                                 

Gene name
UPF3B
Definition
(RefSeq) UPF3 regulator of nonsense transcripts homolog B (yeast)
  KO
K14328  regulator of nonsense transcripts 3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03013  RNA transport
ocu03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    100341564 (UPF3B)
   03015 mRNA surveillance pathway
    100341564 (UPF3B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100341564 (UPF3B)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Surveillance complex
     100341564 (UPF3B)
   mRNA cycle factors
    P-body specific factors
     100341564 (UPF3B)
SSDB
Motif
Pfam: Smg4_UPF3 RRM_1
Other DBs
NCBI-GeneID: 100341564
NCBI-ProteinID: XP_002720171
Ensembl: ENSOCUG00000010213
UniProt: G1SYU5
LinkDB
Position
X
AA seq 483 aa
MKEEKDHRPKEKRVTLLTPQGATGSVGGTSGDCGKGDDKQDRNKEKKEALSKVVIRRLPP
TLTKEQLQEHLQPMPEHDYFEFFSNDTSLYPHMYARAYINFKNQEDIILFRDRFDGYVFL
DNKGQEYPAIVEFAPFQKAAKKKTKKRDTKVGTIDDDPEYRKFLESYATDNEKMTSTPET
LLEEIEAKNRELIAKKTTPLLSFLKNKQRMREEKREERRRREIERKRQREEERRKWKEEE
KRKRKDIEKLKKIDRVPERDKLRDEPKIKVHRFLLQAVNQKNLLKKPEKGDEKELDKRDK
AKKLDKENLNDERTSGQSCTLPKRSDVEYKDEKPKRPEDDSGRDYRERDRDYERDQERIL
RERERLKRQEEERRRQKERYEKEKAFKRKEEEMKKEKEALRDKGKKNESTESLGSSEKTE
KKEEVVKRDRIRNKDRPAMQLYQPGARSRNRLCPPDDSTKSGDSAIDKKQESGISHRKEG
GEE
NT seq 1452 nt   +upstreamnt  +downstreamnt
atgaaggaagagaaggaccacaggcctaaggagaagcgagtaaccctgttaacgccccag
ggagccacaggcagcgtcggtgggacttcgggggactgcggcaaaggggacgataagcag
gatcgcaataaagagaagaaagaggcgctgagcaaggtggtaattcgaagattacctccc
actctgaccaaggagcagcttcaggaacatcttcaacccatgcctgagcatgattatttt
gagtttttttctaatgatactagtctgtatcctcatatgtatgccagagcatacatcaac
tttaaaaaccaagaggacattatcttgttcagggatcggtttgatggctatgtattcctt
gacaataaaggtcaggaatatcctgctatagtagaatttgcaccttttcaaaaagctgca
aaaaagaagactaagaaaagagataccaaagttggaactattgatgatgatccagaatat
agaaaatttttggaaagttatgctacagacaatgagaaaatgacatctactccagagaca
ctgctagaggaaatagaagcaaaaaatagagaattaatagctaaaaagacaaccccactt
ttgagcttcctgaaaaacaagcagagaatgagagaagaaaagagagaagaaagaaggcga
cgagaaatagaaagaaaacggcagagggaagaagagagaagaaagtggaaagaagaagag
aaacgaaaaaggaaagatatagaaaagctgaagaagatagacagagttccagaaagggac
aaattaagggatgaaccaaagataaaggtacacaggtttctgttacaagctgtgaatcag
aaaaatttgctcaagaaaccagaaaagggagatgaaaaagaattggacaaaagagacaaa
gccaagaaactggataaagagaatctgaatgatgagcgaaccagtgggcaaagctgtacg
ttgcccaagcgttctgatgttgaatataaagatgaaaagccaaagagacctgaagatgac
agtggcagagactacagggagagggatcgcgactacgaacgagatcaggagcgcatactg
agagagagagagagactgaagcggcaagaagaagagcgccgtaggcagaaggagcgttat
gagaaagagaaggcttttaagagaaaagaagaagaaatgaagaaagaaaaagaagcactt
cgggataaaggaaagaagaatgaaagcacagaatcattaggcagctcagaaaaaactgaa
aagaaagaggaagtggttaagagagatcgcataagaaacaaggatcgcccagcaatgcag
ctttaccaaccaggagctcgaagccgaaatcgactctgtccccctgacgacagcaccaag
tctggagattcagcaatagacaaaaagcaggaaagtggtattagccatagaaaagaaggg
ggagaggagtga

KEGG   Oryctolagus cuniculus (rabbit): 103346328
Entry
103346328         CDS       T03373                                 

Gene name
UPF3A
Definition
(RefSeq) UPF3 regulator of nonsense transcripts homolog A (yeast)
  KO
K14328  regulator of nonsense transcripts 3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03013  RNA transport
ocu03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    103346328 (UPF3A)
   03015 mRNA surveillance pathway
    103346328 (UPF3A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    103346328 (UPF3A)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Surveillance complex
     103346328 (UPF3A)
   mRNA cycle factors
    P-body specific factors
     103346328 (UPF3A)
SSDB
Motif
Pfam: Smg4_UPF3 LSM_int_assoc
Other DBs
NCBI-GeneID: 103346328
NCBI-ProteinID: XP_008250492
LinkDB
Position
Un
AA seq 361 aa
MEIPFRRELGTPPASSSGCGSGAGRAREEKRAALSKVVVRRLPPGLTKRQLEEQLRPLPA
HDYFELFSADLSLCPHLYSRAYINFRNPDDILLFRDRFDGFIFIDSKGLEYPAVVEFAPF
QKVAKKKLKKKDAKTGSIEDDPEYKRFLEAYSVEEEKTSASPETLLGELEARARELTARR
TTPLLEYIKNRKLEKQRIREEKREERRRRELEKKRLREEEKRKRREEERCKRKEADKQKK
TAEKEVKIKLLKKPEKGEEPTTEKPKERGEETDIGDGKLETCASCTVVKARSLESSLEEL
REKTSRPCSCISQELASEYVSVAKDPLRRAVAGGVGRQKTQQGLVPRRVKRQSESLCAPC
L
NT seq 1086 nt   +upstreamnt  +downstreamnt
atggagatcccgttccgacgagagctcgggacgccgccagcctcgtcctccggctgcggg
agcggcgcgggcagagctcgcgaggagaagagggccgcgctcagcaaggtggtggtgcgg
cggctcccgcccggcctcaccaagcggcagctggaggagcagctgcgcccgctgcccgcg
cacgactacttcgagcttttctcggcggacctcagtctgtgtcctcacctctactcgaga
gcatacatcaattttaggaatcctgatgacatccttcttttccgagatcgttttgatgga
tttatcttcattgacagcaaaggcctggagtacccagctgtggttgaatttgctccgttc
cagaaggtagccaagaaaaagctgaagaagaaagatgccaagactggaagcatcgaagac
gatcctgagtacaagaggtttttagaagcttactctgtggaagaagagaaaaccagtgcc
agtcctgaaactctcctgggagaactggaggcgagggcgagggagctcactgctagaaga
actacacctcttttggaatatattaaaaatagaaaattggaaaagcagagaattcgggag
gagaaacgagaagaacgaaggagaagagagttagaaaagaaacgcttgcgggaagaagag
aaaagaaaaagaagagaagaggagagatgcaaaagaaaagaggcagataagcaaaagaaa
actgcagagaaagaagtaaagattaagcttcttaagaaaccagaaaagggagaggaacca
actacagagaaaccaaaagaaagaggcgaggaaactgatattggagatggaaagctggag
acctgtgcttcctgcacagtcgtgaaggccaggtccttggagagctcgctggaggagctc
agggagaagaccagccggccatgcagctgcatcagccaggaactcgcctccgagtatgtg
agtgtggccaaagaccctctgaggagggctgtggcgggaggagtggggaggcagaagact
cagcagggactggtcccgagaagagtgaagaggcagagtgagtccttgtgtgcaccttgt
ttgtga

DBGET integrated database retrieval system